Merged 15170:15635 from trunk (no conflicts or even merges)
authorIan Thompson <quornian@googlemail.com>
Fri, 18 Jul 2008 23:35:34 +0000 (23:35 +0000)
committerIan Thompson <quornian@googlemail.com>
Fri, 18 Jul 2008 23:35:34 +0000 (23:35 +0000)
401 files changed:
CMakeLists.txt
README
blenderplayer/CMakeLists.txt
extern/CMakeLists.txt
extern/Makefile
extern/SConscript
extern/glew/CMakeLists.txt [new file with mode: 0644]
extern/glew/README.txt [new file with mode: 0644]
extern/glew/SConscript [new file with mode: 0644]
extern/glew/include/GL/glew.h [new file with mode: 0644]
extern/glew/include/GL/glxew.h [new file with mode: 0644]
extern/glew/include/GL/wglew.h [new file with mode: 0644]
extern/glew/make/msvc_7_0/glew_vc7.vcproj [new file with mode: 0644]
extern/glew/src/Makefile [new file with mode: 0644]
extern/glew/src/glew.c [new file with mode: 0644]
extern/libopenjpeg/opj_malloc.h
extern/libopenjpeg/patches/osx.patch [new file with mode: 0644]
extern/libredcode/debayer.c
extern/make/msvc_7_0/extern.sln
intern/bsp/intern/BSP_CSGMesh.cpp
intern/container/CTR_TaggedIndex.h
intern/decimation/intern/LOD_ManMesh2.cpp
intern/elbeem/intern/solver_init.cpp
intern/ghost/intern/GHOST_SystemWin32.cpp
intern/ghost/intern/GHOST_SystemX11.cpp
intern/ghost/intern/GHOST_WindowWin32.cpp
intern/iksolver/intern/IK_QTask.h
intern/moto/include/GEN_Map.h
intern/moto/include/MT_random.h
intern/moto/intern/MT_random.cpp
projectfiles_vc7/blender/blender.vcproj
projectfiles_vc7/blender/blenkernel/BKE_blenkernel.vcproj
projectfiles_vc7/blender/blenlib/BLI_blenlib.vcproj
projectfiles_vc7/blender/render/BRE_render.vcproj
projectfiles_vc7/blender/src/BL_src.vcproj
projectfiles_vc7/gameengine/blenderhook/KX_blenderhook.vcproj
projectfiles_vc7/gameengine/converter/KX_converter.vcproj
projectfiles_vc7/gameengine/gamelogic/SCA_GameLogic.vcproj
projectfiles_vc7/gameengine/gameplayer/common/GP_common.vcproj
projectfiles_vc7/gameengine/gameplayer/ghost/GP_ghost.vcproj
projectfiles_vc7/gameengine/ketsji/KX_ketsji.vcproj
projectfiles_vc7/gameengine/rasterizer/RAS_rasterizer.vcproj
projectfiles_vc7/gameengine/rasterizer/openglrasterizer/RAS_openglrasterizer.vcproj
release/datafiles/blenderbuttons
release/scripts/DirectX8Exporter.py
release/scripts/animation_bake_constraints.py [new file with mode: 0644]
release/scripts/bpymodules/BPyArmature.py
release/scripts/c3d_import.py [new file with mode: 0644]
release/scripts/ms3d_import.py
release/scripts/vrml97_export.py
release/windows/installer/00.sconsblender.nsi
source/Makefile
source/blender/blenkernel/BKE_action.h
source/blender/blenkernel/BKE_bmesh.h
source/blender/blenkernel/BKE_bmeshCustomData.h
source/blender/blenkernel/BKE_cloth.h
source/blender/blenkernel/BKE_customdata.h
source/blender/blenkernel/BKE_ipo.h
source/blender/blenkernel/BKE_key.h
source/blender/blenkernel/BKE_object.h
source/blender/blenkernel/BKE_scene.h
source/blender/blenkernel/intern/BME_Customdata.c
source/blender/blenkernel/intern/BME_conversions.c
source/blender/blenkernel/intern/BME_eulers.c
source/blender/blenkernel/intern/BME_mesh.c
source/blender/blenkernel/intern/BME_structure.c
source/blender/blenkernel/intern/BME_tools.c
source/blender/blenkernel/intern/DerivedMesh.c
source/blender/blenkernel/intern/action.c
source/blender/blenkernel/intern/armature.c
source/blender/blenkernel/intern/bmesh_private.h
source/blender/blenkernel/intern/cdderivedmesh.c
source/blender/blenkernel/intern/cloth.c
source/blender/blenkernel/intern/collision.c
source/blender/blenkernel/intern/customdata.c
source/blender/blenkernel/intern/image.c
source/blender/blenkernel/intern/implicit.c
source/blender/blenkernel/intern/ipo.c
source/blender/blenkernel/intern/key.c
source/blender/blenkernel/intern/library.c
source/blender/blenkernel/intern/modifier.c
source/blender/blenkernel/intern/object.c
source/blender/blenkernel/intern/particle.c
source/blender/blenkernel/intern/particle_system.c
source/blender/blenkernel/intern/pointcache.c
source/blender/blenkernel/intern/sca.c
source/blender/blenkernel/intern/text.c
source/blender/blenlib/BLI_arithb.h
source/blender/blenlib/BLI_mempool.h [new file with mode: 0644]
source/blender/blenlib/BLI_winstuff.h
source/blender/blenlib/intern/BLI_kdopbvh.c
source/blender/blenlib/intern/BLI_mempool.c [new file with mode: 0644]
source/blender/blenlib/intern/arithb.c
source/blender/blenlib/intern/util.c
source/blender/blenloader/intern/readfile.c
source/blender/blenloader/intern/writefile.c
source/blender/imbuf/IMB_imbuf_types.h
source/blender/imbuf/intern/IMB_anim.h
source/blender/imbuf/intern/anim.c
source/blender/imbuf/intern/cineon/dpxlib.c
source/blender/imbuf/intern/openexr/openexr_api.cpp
source/blender/include/BDR_drawobject.h
source/blender/include/BDR_editcurve.h
source/blender/include/BIF_butspace.h
source/blender/include/BIF_editaction.h
source/blender/include/BIF_editarmature.h
source/blender/include/BIF_interface.h
source/blender/include/BIF_oops.h
source/blender/include/BIF_resources.h
source/blender/include/BSE_sequence.h
source/blender/include/BSE_view.h
source/blender/include/blendef.h
source/blender/include/butspace.h
source/blender/include/transform.h
source/blender/makesdna/DNA_actuator_types.h
source/blender/makesdna/DNA_controller_types.h
source/blender/makesdna/DNA_customdata_types.h
source/blender/makesdna/DNA_lamp_types.h
source/blender/makesdna/DNA_meshdata_types.h
source/blender/makesdna/DNA_modifier_types.h
source/blender/makesdna/DNA_object_types.h
source/blender/makesdna/DNA_scene_types.h
source/blender/makesdna/DNA_sensor_types.h
source/blender/makesdna/DNA_space_types.h
source/blender/makesdna/DNA_userdef_types.h
source/blender/nodes/intern/CMP_nodes/CMP_gamma.c
source/blender/nodes/intern/CMP_nodes/CMP_math.c
source/blender/nodes/intern/SHD_nodes/SHD_math.c
source/blender/python/BPY_interface.c
source/blender/python/api2_2x/CurNurb.c
source/blender/python/api2_2x/Lamp.c
source/blender/python/api2_2x/Mathutils.c
source/blender/python/api2_2x/doc/Curve.py
source/blender/python/api2_2x/doc/Render.py
source/blender/python/api2_2x/matrix.c
source/blender/python/api2_2x/sceneRender.c
source/blender/python/api2_2x/sceneSequence.c
source/blender/radiosity/intern/source/radrender.c
source/blender/render/intern/include/pixelshading.h
source/blender/render/intern/include/render_types.h
source/blender/render/intern/include/sunsky.h [new file with mode: 0644]
source/blender/render/intern/source/convertblender.c
source/blender/render/intern/source/pipeline.c
source/blender/render/intern/source/pixelshading.c
source/blender/render/intern/source/rendercore.c
source/blender/render/intern/source/shadbuf.c
source/blender/render/intern/source/sunsky.c [new file with mode: 0644]
source/blender/render/intern/source/zbuf.c
source/blender/src/CMakeLists.txt
source/blender/src/Makefile
source/blender/src/SConscript
source/blender/src/blenderbuttons.c
source/blender/src/buttons_editing.c
source/blender/src/buttons_logic.c
source/blender/src/buttons_object.c
source/blender/src/buttons_scene.c
source/blender/src/buttons_shading.c
source/blender/src/drawaction.c
source/blender/src/drawarmature.c
source/blender/src/drawimage.c
source/blender/src/drawmesh.c
source/blender/src/drawnode.c
source/blender/src/drawobject.c
source/blender/src/drawoops.c
source/blender/src/drawview.c
source/blender/src/editaction.c
source/blender/src/editarmature.c
source/blender/src/editcurve.c
source/blender/src/editfont.c
source/blender/src/editmesh.c
source/blender/src/editmesh_add.c
source/blender/src/editmesh_lib.c
source/blender/src/editmesh_mods.c
source/blender/src/editnla.c
source/blender/src/editobject.c
source/blender/src/editparticle.c
source/blender/src/editseq.c
source/blender/src/editsima.c
source/blender/src/editsound.c
source/blender/src/edittime.c
source/blender/src/header_image.c
source/blender/src/header_oops.c
source/blender/src/header_view3d.c
source/blender/src/headerbuttons.c
source/blender/src/interface.c
source/blender/src/interface_draw.c
source/blender/src/oops.c
source/blender/src/poselib.c
source/blender/src/poseobject.c
source/blender/src/resources.c
source/blender/src/sequence.c
source/blender/src/space.c
source/blender/src/transform.c
source/blender/src/transform_constraints.c
source/blender/src/transform_conversions.c
source/blender/src/transform_generics.c
source/blender/src/transform_snap.c
source/blender/src/usiblender.c
source/blender/src/view.c
source/blender/src/vpaint.c
source/creator/CMakeLists.txt
source/creator/creator.c
source/gameengine/BlenderRoutines/BL_KetsjiEmbedStart.cpp
source/gameengine/BlenderRoutines/CMakeLists.txt
source/gameengine/BlenderRoutines/KX_BlenderCanvas.h
source/gameengine/BlenderRoutines/KX_BlenderGL.cpp
source/gameengine/BlenderRoutines/KX_BlenderRenderTools.cpp
source/gameengine/BlenderRoutines/KX_BlenderRenderTools.h
source/gameengine/BlenderRoutines/Makefile
source/gameengine/BlenderRoutines/SConscript
source/gameengine/BlenderRoutines/mac_compat_glext.h [deleted file]
source/gameengine/Converter/BL_ActionActuator.cpp
source/gameengine/Converter/BL_ActionActuator.h
source/gameengine/Converter/BL_ArmatureObject.cpp
source/gameengine/Converter/BL_BlenderDataConversion.cpp
source/gameengine/Converter/BL_DeformableGameObject.cpp
source/gameengine/Converter/BL_DeformableGameObject.h
source/gameengine/Converter/BL_MeshDeformer.cpp
source/gameengine/Converter/BL_MeshDeformer.h
source/gameengine/Converter/BL_ShapeActionActuator.cpp [new file with mode: 0644]
source/gameengine/Converter/BL_ShapeActionActuator.h [new file with mode: 0644]
source/gameengine/Converter/BL_ShapeDeformer.cpp [new file with mode: 0644]
source/gameengine/Converter/BL_ShapeDeformer.h [new file with mode: 0644]
source/gameengine/Converter/BL_SkinDeformer.cpp
source/gameengine/Converter/BL_SkinDeformer.h
source/gameengine/Converter/BL_SkinMeshObject.cpp
source/gameengine/Converter/BL_SkinMeshObject.h
source/gameengine/Converter/KX_BlenderSceneConverter.cpp
source/gameengine/Converter/KX_BlenderSceneConverter.h
source/gameengine/Converter/KX_ConvertActuators.cpp
source/gameengine/Converter/KX_ConvertControllers.cpp
source/gameengine/Converter/KX_ConvertSensors.cpp
source/gameengine/Expressions/PyObjectPlus.h
source/gameengine/Expressions/Value.cpp
source/gameengine/Expressions/Value.h
source/gameengine/GameLogic/SCA_2DFilterActuator.cpp
source/gameengine/GameLogic/SCA_2DFilterActuator.h
source/gameengine/GameLogic/SCA_ActuatorEventManager.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_ActuatorEventManager.h [new file with mode: 0644]
source/gameengine/GameLogic/SCA_ActuatorSensor.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_ActuatorSensor.h [new file with mode: 0644]
source/gameengine/GameLogic/SCA_AlwaysSensor.cpp
source/gameengine/GameLogic/SCA_AlwaysSensor.h
source/gameengine/GameLogic/SCA_EventManager.cpp
source/gameengine/GameLogic/SCA_EventManager.h
source/gameengine/GameLogic/SCA_IActuator.cpp
source/gameengine/GameLogic/SCA_IActuator.h
source/gameengine/GameLogic/SCA_IController.cpp
source/gameengine/GameLogic/SCA_IController.h
source/gameengine/GameLogic/SCA_ILogicBrick.cpp
source/gameengine/GameLogic/SCA_ILogicBrick.h
source/gameengine/GameLogic/SCA_IObject.cpp
source/gameengine/GameLogic/SCA_IObject.h
source/gameengine/GameLogic/SCA_ISensor.cpp
source/gameengine/GameLogic/SCA_ISensor.h
source/gameengine/GameLogic/SCA_JoystickSensor.cpp
source/gameengine/GameLogic/SCA_JoystickSensor.h
source/gameengine/GameLogic/SCA_KeyboardSensor.cpp
source/gameengine/GameLogic/SCA_KeyboardSensor.h
source/gameengine/GameLogic/SCA_LogicManager.cpp
source/gameengine/GameLogic/SCA_MouseSensor.cpp
source/gameengine/GameLogic/SCA_MouseSensor.h
source/gameengine/GameLogic/SCA_NANDController.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_NANDController.h [new file with mode: 0644]
source/gameengine/GameLogic/SCA_NORController.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_NORController.h [new file with mode: 0644]
source/gameengine/GameLogic/SCA_PropertySensor.cpp
source/gameengine/GameLogic/SCA_PropertySensor.h
source/gameengine/GameLogic/SCA_PythonController.cpp
source/gameengine/GameLogic/SCA_PythonController.h
source/gameengine/GameLogic/SCA_RandomSensor.cpp
source/gameengine/GameLogic/SCA_RandomSensor.h
source/gameengine/GameLogic/SCA_XNORController.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_XNORController.h [new file with mode: 0644]
source/gameengine/GameLogic/SCA_XORController.cpp [new file with mode: 0644]
source/gameengine/GameLogic/SCA_XORController.h [new file with mode: 0644]
source/gameengine/GamePlayer/common/CMakeLists.txt
source/gameengine/GamePlayer/common/GPC_Canvas.h
source/gameengine/GamePlayer/common/GPC_PolygonMaterial.cpp
source/gameengine/GamePlayer/common/GPC_RenderTools.cpp
source/gameengine/GamePlayer/common/GPC_RenderTools.h
source/gameengine/GamePlayer/common/Makefile
source/gameengine/GamePlayer/common/SConscript
source/gameengine/GamePlayer/ghost/CMakeLists.txt
source/gameengine/GamePlayer/ghost/GPG_Application.cpp
source/gameengine/GamePlayer/ghost/GPG_Application.h
source/gameengine/GamePlayer/ghost/GPG_ghost.cpp
source/gameengine/GamePlayer/ghost/Makefile
source/gameengine/GamePlayer/ghost/SConscript
source/gameengine/Ketsji/BL_BlenderShader.cpp [new file with mode: 0644]
source/gameengine/Ketsji/BL_BlenderShader.h [new file with mode: 0644]
source/gameengine/Ketsji/BL_Material.cpp
source/gameengine/Ketsji/BL_Material.h
source/gameengine/Ketsji/BL_Shader.cpp
source/gameengine/Ketsji/BL_Texture.cpp
source/gameengine/Ketsji/CMakeLists.txt
source/gameengine/Ketsji/KXNetwork/KX_NetworkMessageActuator.cpp
source/gameengine/Ketsji/KXNetwork/KX_NetworkMessageSensor.cpp
source/gameengine/Ketsji/KXNetwork/KX_NetworkMessageSensor.h
source/gameengine/Ketsji/KX_BlenderMaterial.cpp
source/gameengine/Ketsji/KX_BlenderMaterial.h
source/gameengine/Ketsji/KX_BulletPhysicsController.cpp
source/gameengine/Ketsji/KX_BulletPhysicsController.h
source/gameengine/Ketsji/KX_Camera.cpp
source/gameengine/Ketsji/KX_ConstraintActuator.cpp
source/gameengine/Ketsji/KX_ConstraintActuator.h
source/gameengine/Ketsji/KX_GameObject.cpp
source/gameengine/Ketsji/KX_GameObject.h
source/gameengine/Ketsji/KX_IPO_SGController.cpp
source/gameengine/Ketsji/KX_IPO_SGController.h
source/gameengine/Ketsji/KX_IPhysicsController.h
source/gameengine/Ketsji/KX_ISceneConverter.h
source/gameengine/Ketsji/KX_IpoActuator.cpp
source/gameengine/Ketsji/KX_IpoActuator.h
source/gameengine/Ketsji/KX_KetsjiEngine.cpp
source/gameengine/Ketsji/KX_KetsjiEngine.h
source/gameengine/Ketsji/KX_Light.cpp
source/gameengine/Ketsji/KX_Light.h
source/gameengine/Ketsji/KX_MeshProxy.cpp
source/gameengine/Ketsji/KX_MouseFocusSensor.cpp
source/gameengine/Ketsji/KX_MouseFocusSensor.h
source/gameengine/Ketsji/KX_NearSensor.cpp
source/gameengine/Ketsji/KX_ObjectActuator.cpp
source/gameengine/Ketsji/KX_ObjectActuator.h
source/gameengine/Ketsji/KX_OdePhysicsController.cpp
source/gameengine/Ketsji/KX_OdePhysicsController.h
source/gameengine/Ketsji/KX_ParentActuator.cpp
source/gameengine/Ketsji/KX_PhysicsObjectWrapper.cpp
source/gameengine/Ketsji/KX_PyConstraintBinding.cpp
source/gameengine/Ketsji/KX_PythonInit.cpp
source/gameengine/Ketsji/KX_PythonInit.h
source/gameengine/Ketsji/KX_RadarSensor.cpp
source/gameengine/Ketsji/KX_RayCast.cpp
source/gameengine/Ketsji/KX_RaySensor.cpp
source/gameengine/Ketsji/KX_RaySensor.h
source/gameengine/Ketsji/KX_SCA_AddObjectActuator.cpp
source/gameengine/Ketsji/KX_SCA_AddObjectActuator.h
source/gameengine/Ketsji/KX_SCA_DynamicActuator.cpp [new file with mode: 0644]
source/gameengine/Ketsji/KX_SCA_DynamicActuator.h [new file with mode: 0644]
source/gameengine/Ketsji/KX_SG_NodeRelationships.h
source/gameengine/Ketsji/KX_Scene.cpp
source/gameengine/Ketsji/KX_Scene.h
source/gameengine/Ketsji/KX_SoundActuator.cpp
source/gameengine/Ketsji/KX_StateActuator.cpp [new file with mode: 0644]
source/gameengine/Ketsji/KX_StateActuator.h [new file with mode: 0644]
source/gameengine/Ketsji/KX_SumoPhysicsController.cpp
source/gameengine/Ketsji/KX_SumoPhysicsController.h
source/gameengine/Ketsji/KX_TouchEventManager.cpp
source/gameengine/Ketsji/KX_TouchSensor.cpp
source/gameengine/Ketsji/KX_TouchSensor.h
source/gameengine/Ketsji/KX_TrackToActuator.cpp
source/gameengine/Ketsji/KX_VehicleWrapper.cpp
source/gameengine/Ketsji/Makefile
source/gameengine/Ketsji/SConscript
source/gameengine/PyDoc/BL_ActionActuator.py
source/gameengine/PyDoc/KX_GameObject.py
source/gameengine/PyDoc/SCA_PythonController.py
source/gameengine/Rasterizer/CMakeLists.txt
source/gameengine/Rasterizer/Makefile
source/gameengine/Rasterizer/RAS_2DFilterManager.cpp
source/gameengine/Rasterizer/RAS_2DFilterManager.h
source/gameengine/Rasterizer/RAS_BucketManager.cpp
source/gameengine/Rasterizer/RAS_CameraData.h
source/gameengine/Rasterizer/RAS_Deformer.h
source/gameengine/Rasterizer/RAS_IPolygonMaterial.cpp
source/gameengine/Rasterizer/RAS_IPolygonMaterial.h
source/gameengine/Rasterizer/RAS_IRasterizer.h
source/gameengine/Rasterizer/RAS_IRenderTools.h
source/gameengine/Rasterizer/RAS_MaterialBucket.cpp
source/gameengine/Rasterizer/RAS_MaterialBucket.h
source/gameengine/Rasterizer/RAS_MeshObject.cpp
source/gameengine/Rasterizer/RAS_MeshObject.h
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/ARB_multitexture.h [deleted file]
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/CMakeLists.txt
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/EXT_separate_specular_color.h [deleted file]
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/Makefile
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_GLExtensionManager.cpp
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_GLExtensionManager.h
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_ListRasterizer.cpp
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_ListRasterizer.h
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_OpenGLRasterizer.cpp
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_OpenGLRasterizer.h
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_VAOpenGLRasterizer.cpp
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/RAS_VAOpenGLRasterizer.h
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/SConscript
source/gameengine/Rasterizer/RAS_OpenGLRasterizer/mkglext.py [deleted file]
source/gameengine/Rasterizer/RAS_TexVert.cpp
source/gameengine/Rasterizer/RAS_TexVert.h
source/gameengine/Rasterizer/SConscript
source/gameengine/SceneGraph/SG_Controller.h
source/gameengine/SceneGraph/SG_IObject.cpp
source/gameengine/SceneGraph/SG_IObject.h
source/gameengine/SceneGraph/SG_Node.cpp
source/gameengine/SceneGraph/SG_Node.h
source/gameengine/SceneGraph/SG_ParentRelation.h
source/gameengine/SceneGraph/SG_Spatial.cpp
source/gameengine/SceneGraph/SG_Spatial.h
source/kernel/gen_system/GEN_HashedPtr.h
source/kernel/gen_system/GEN_Map.h
source/nan_definitions.mk
tools/Blender.py

index b58fe9456639abdd060aa9f9f6812e3083a54bbb..5a23e77d9f81fa04100e840f1bab164e442a317f 100644 (file)
@@ -197,10 +197,17 @@ IF(UNIX)
 ENDIF(UNIX)
 
 IF(WIN32)
-  INCLUDE(${CMAKE_ROOT}/Modules/Platform/Windows-cl.cmake)
 
+  INCLUDE(${CMAKE_ROOT}/Modules/Platform/Windows-cl.cmake)
+  
   SET(LIBDIR ${CMAKE_SOURCE_DIR}/../lib/windows)
 
+  # Setup 64bit and 64bit windows systems
+  IF(CMAKE_CL_64)
+    message("64 bit compiler detected.")
+    SET(LIBDIR ${CMAKE_SOURCE_DIR}/../lib/win64)
+  ENDIF(CMAKE_CL_64)
+
   SET(PYTHON ${LIBDIR}/python)
   SET(PYTHON_VERSION 2.5)
   SET(PYTHON_INC "${PYTHON}/include/python${PYTHON_VERSION}")
@@ -214,12 +221,20 @@ IF(WIN32)
   SET(OPENAL_LIB openal_static)
   SET(OPENAL_LIBPATH ${OPENAL}/lib)
 
-  SET(PNG_LIB libpng_st)
+  IF(CMAKE_CL_64)
+       SET(PNG_LIB libpng)
+  ELSE(CMAKE_CL_64)
+       SET(PNG_LIB libpng_st)
+  ENDIF(CMAKE_CL_64)
   SET(JPEG_LIB libjpeg)
 
   SET(ZLIB ${LIBDIR}/zlib)
   SET(ZLIB_INC ${ZLIB}/include)
-  SET(ZLIB_LIB libz)
+  IF(CMAKE_CL_64)
+       SET(ZLIB_LIB zlib)
+  ELSE(CMAKE_CL_64)
+       SET(ZLIB_LIB libz)
+  ENDIF(CMAKE_CL_64)
   SET(ZLIB_LIBPATH ${ZLIB}/lib)
   
   SET(PTHREADS ${LIBDIR}/pthreads)
@@ -302,7 +317,11 @@ IF(WIN32)
   
   SET(WINTAB_INC ${LIBDIR}/wintab/include) 
 
-  SET(PLATFORM_LINKFLAGS "/NODEFAULTLIB:libc.lib")
+  IF(CMAKE_CL_64)
+  SET(PLATFORM_LINKFLAGS "/NODEFAULTLIB:libc.lib;MSVCRT.lib ")
+  ELSE(CMAKE_CL_64)
+  SET(PLATFORM_LINKFLAGS "/NODEFAULTLIB:libc.lib ")
+  ENDIF(CMAKE_CL_64)
   SET(CMAKE_EXE_LINKER_FLAGS_DEBUG "${CMAKE_EXE_LINKER_FLAGS_DEBUG} /NODEFAULTLIB:libcmt.lib;libc.lib ")
 ENDIF(WIN32)
 
diff --git a/README b/README
index d123a90ba486eff7251016859e56a26280b6fb61..1a7964f954e4a2366d58e8295aefff6f92786cfd 100644 (file)
--- a/README
+++ b/README
@@ -24,22 +24,22 @@ dir to one of these locations (your home directory being recommended).
 -------------------------------------Links--------------------------------------
 
 Getting Involved:
-http://www.blender.org/docs/get_involved.html
+http://www.blender.org/community/get-involved
 
 Community:
-http://www.blender3d.org/Community/
+http://www.blender.org/Community
 
 Main blender development site:
-http://www.blender.org/
+http://www.blender.org
 
 The Blender project homepage:
-http://projects.blender.org/projects/bf-blender/
+http://projects.blender.org/projects/bf-blender
 
 Documentation:
-http://www.blender.org/modules.php?op=modload&name=documentation&file=index
+http://www.blender.org/education-help
 
 Bug tracker:
-http://projects.blender.org/tracker/?atid=125&group_id=9&func=browse
+http://www.blender.org/development/report-a-bug
 
 Feature request tracker:
-http://projects.blender.org/tracker/?atid=128&group_id=9&func=browse
+http://wiki.blender.org/index.php/Requests
index 62b64ff04bb7bb1112d5f96fc39352504b1af763..d90639562d22ca21210f19c1b07360929cf2c63d 100644 (file)
@@ -108,6 +108,7 @@ IF(UNIX)
     blenkernel_blc
     bf_quicktime
     extern_binreloc
+       extern_glew
   ) 
 
   FOREACH(SORTLIB ${BLENDER_SORTED_LIBS})
index d092e0d494d0affb3a5d5b542358bc70cc6fe1e2..ee5cab31e092c81012a283c78f879276bfbe34a7 100644 (file)
@@ -43,3 +43,6 @@ ENDIF(WITH_VERSE)
 IF(CMAKE_SYSTEM_NAME MATCHES "Linux")
   SUBDIRS(binreloc)
 ENDIF(CMAKE_SYSTEM_NAME MATCHES "Linux")
+
+SUBDIRS(glew)
+
index fd4573cc8b1f685ba9151ed6058a34a07ff46986..26ee25b608f0049f3777f5d57086f8ca5752ff98 100644 (file)
@@ -30,7 +30,7 @@ include nan_definitions.mk
 
 SOURCEDIR = extern
 DIR = $(OCGDIR)/extern
-DIRS = qhull/src solid 
+DIRS = qhull/src solid glew/src
 
 ifeq ($(WITH_FREETYPE2), true)
     DIRS += bFTGL/src
index c94b6573eb97340c0ab94876f0ff23b7aee1484b..6612d38f4cfc6f3bc55360679ea1aa557c04950b 100644 (file)
@@ -2,6 +2,8 @@
 
 Import('env')
 
+SConscript(['glew/SConscript'])
+
 if env['WITH_BF_GAMEENGINE']:
     SConscript(['qhull/SConscript',
             'solid/SConscript'])
diff --git a/extern/glew/CMakeLists.txt b/extern/glew/CMakeLists.txt
new file mode 100644 (file)
index 0000000..53ef014
--- /dev/null
@@ -0,0 +1,33 @@
+# $Id$
+# ***** BEGIN GPL LICENSE BLOCK *****
+#
+# This program is free software; you can redistribute it and/or
+# modify it under the terms of the GNU General Public License
+# as published by the Free Software Foundation; either version 2
+# of the License, or (at your option) any later version.
+#
+# This program is distributed in the hope that it will be useful,
+# but WITHOUT ANY WARRANTY; without even the implied warranty of
+# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+# GNU General Public License for more details.
+#
+# You should have received a copy of the GNU General Public License
+# along with this program; if not, write to the Free Software Foundation,
+# Inc., 59 Temple Place - Suite 330, Boston, MA  02111-1307, USA.
+#
+# The Original Code is Copyright (C) 2006, Blender Foundation
+# All rights reserved.
+#
+# The Original Code is: all of this file.
+#
+# Contributor(s): Jacques Beaurain.
+#
+# ***** END GPL LICENSE BLOCK *****
+
+SET(INC include src)
+
+SET(SRC
+  src/glew.c
+)
+
+BLENDERLIB(extern_glew "${SRC}" "${INC}")
diff --git a/extern/glew/README.txt b/extern/glew/README.txt
new file mode 100644 (file)
index 0000000..1b19c53
--- /dev/null
@@ -0,0 +1,18 @@
+See doc/index.html for more information.
+
+If you downloaded the tarball from the GLEW website, you just need to:
+
+    Unix:
+
+        make
+
+    Windows:
+
+        use the project file in build/vc6/
+
+If you wish to build GLEW from scratch (update the extension data from
+the net or add your own extension information), you need a Unix
+environment (including wget, perl, and GNU make).  The extension data
+is regenerated from the top level source directory with:
+
+        make extensions
diff --git a/extern/glew/SConscript b/extern/glew/SConscript
new file mode 100644 (file)
index 0000000..32b3b47
--- /dev/null
@@ -0,0 +1,12 @@
+#!/usr/bin/python
+import sys
+import os
+
+Import('env')
+
+sources = ['src/glew.c']
+
+defs = ''
+incs = 'include'
+
+env.BlenderLib ( 'extern_glew', sources, Split(incs), Split(defs), libtype=['intern', 'player'], priority=[25, 50])
diff --git a/extern/glew/include/GL/glew.h b/extern/glew/include/GL/glew.h
new file mode 100644 (file)
index 0000000..fd3fe10
--- /dev/null
@@ -0,0 +1,9797 @@
+/*
+** The OpenGL Extension Wrangler Library
+** Copyright (C) 2002-2006, Milan Ikits <milan ikits[]ieee org>
+** Copyright (C) 2002-2006, Marcelo E. Magallon <mmagallo[]debian org>
+** Copyright (C) 2002, Lev Povalahev
+** All rights reserved.
+** 
+** Redistribution and use in source and binary forms, with or without 
+** modification, are permitted provided that the following conditions are met:
+** 
+** * Redistributions of source code must retain the above copyright notice, 
+**   this list of conditions and the following disclaimer.
+** * Redistributions in binary form must reproduce the above copyright notice, 
+**   this list of conditions and the following disclaimer in the documentation 
+**   and/or other materials provided with the distribution.
+** * The name of the author may be used to endorse or promote products 
+**   derived from this software without specific prior written permission.
+**
+** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" 
+** AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE 
+** IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE
+** ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT OWNER OR CONTRIBUTORS BE 
+** LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR 
+** CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF 
+** SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS
+** INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN
+** CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE)
+** ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF
+** THE POSSIBILITY OF SUCH DAMAGE.
+*/
+
+/*
+** License Applicability. Except to the extent portions of this file are
+** made subject to an alternative license as permitted in the SGI Free
+** Software License B, Version 1.1 (the "License"), the contents of this
+** file are subject only to the provisions of the License. You may not use
+** this file except in compliance with the License. You may obtain a copy
+** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+** 
+** http://oss.sgi.com/projects/FreeB
+** 
+** Note that, as provided in the License, the Software is distributed on an
+** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS
+** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND
+** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A
+** PARTICULAR PURPOSE, AND NON-INFRINGEMENT.
+** 
+** Original Code. The Original Code is: OpenGL Sample Implementation,
+** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
+** Copyright in any portions created by third parties is as indicated
+** elsewhere herein. All Rights Reserved.
+** 
+** Additional Notice Provisions: This software was created using the
+** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+** not been independently verified as being compliant with the OpenGL(R)
+** version 1.2.1 Specification.
+*/
+
+/* added this here for blender, should be moved elsewhere */
+#define GLEW_STATIC
+
+#ifndef __glew_h__
+#define __glew_h__
+#define __GLEW_H__
+
+#if defined(__gl_h_) || defined(__GL_H__)
+#error gl.h included before glew.h
+#endif
+#if defined(__glext_h_) || defined(__GLEXT_H_)
+#error glext.h included before glew.h
+#endif
+#if defined(__gl_ATI_h_)
+#error glATI.h included before glew.h
+#endif
+
+#define __gl_h_
+#define __GL_H__
+#define __glext_h_
+#define __GLEXT_H_
+#define __gl_ATI_h_
+
+#if defined(_WIN32) || defined(__CYGWIN__) || defined(__MINGW32__)
+
+/*
+ * GLEW does not include <windows.h> to avoid name space pollution.
+ * GL needs GLAPI and GLAPIENTRY, GLU needs APIENTRY, CALLBACK, and wchar_t
+ * defined properly.
+ */
+/* <windef.h> */
+#ifndef APIENTRY
+#define GLEW_APIENTRY_DEFINED
+#  if defined(__CYGWIN__) || defined(__MINGW32__)
+#    define APIENTRY __stdcall
+#  elif (_MSC_VER >= 800) || defined(_STDCALL_SUPPORTED) || defined(__BORLANDC__)
+#    define APIENTRY __stdcall
+#  else
+#    define APIENTRY
+#  endif
+#endif
+#ifndef GLAPI
+#  if defined(__CYGWIN__) || defined(__MINGW32__)
+#    define GLAPI extern
+#  endif
+#endif
+/* <winnt.h> */
+#ifndef CALLBACK
+#define GLEW_CALLBACK_DEFINED
+#  if defined(__CYGWIN__) || defined(__MINGW32__)
+#    define CALLBACK __attribute__ ((__stdcall__))
+#  elif (defined(_M_MRX000) || defined(_M_IX86) || defined(_M_ALPHA) || defined(_M_PPC)) && !defined(MIDL_PASS)
+#    define CALLBACK __stdcall
+#  else
+#    define CALLBACK
+#  endif
+#endif
+/* <wingdi.h> and <winnt.h> */
+#ifndef WINGDIAPI
+#define GLEW_WINGDIAPI_DEFINED
+#define WINGDIAPI __declspec(dllimport)
+#endif
+/* <ctype.h> */
+#if (defined(_MSC_VER) || defined(__BORLANDC__)) && !defined(_WCHAR_T_DEFINED)
+typedef unsigned short wchar_t;
+#  define _WCHAR_T_DEFINED
+#endif
+/* <stddef.h> */
+#if !defined(_W64)
+#  if !defined(__midl) && (defined(_X86_) || defined(_M_IX86)) && _MSC_VER >= 1300
+#    define _W64 __w64
+#  else
+#    define _W64
+#  endif
+#endif
+#if !defined(_PTRDIFF_T_DEFINED) && !defined(_PTRDIFF_T_)
+#  ifdef _WIN64
+typedef __int64 ptrdiff_t;
+#  else
+typedef _W64 int ptrdiff_t;
+#  endif
+#  define _PTRDIFF_T_DEFINED
+#  define _PTRDIFF_T_
+#endif
+
+#ifndef GLAPI
+#  if defined(__CYGWIN__) || defined(__MINGW32__)
+#    define GLAPI extern
+#  else
+#    define GLAPI WINGDIAPI
+#  endif
+#endif
+
+#ifndef GLAPIENTRY
+#define GLAPIENTRY APIENTRY
+#endif
+
+/*
+ * GLEW_STATIC needs to be set when using the static version.
+ * GLEW_BUILD is set when building the DLL version.
+ */
+#ifdef GLEW_STATIC
+#  define GLEWAPI extern
+#else
+#  ifdef GLEW_BUILD
+#    define GLEWAPI extern __declspec(dllexport)
+#  else
+#    define GLEWAPI extern __declspec(dllimport)
+#  endif
+#endif
+
+#else /* _UNIX */
+
+/*
+ * Needed for ptrdiff_t in turn needed by VBO.  This is defined by ISO
+ * C.  On my system, this amounts to _3 lines_ of included code, all of
+ * them pretty much harmless.  If you know of a way of detecting 32 vs
+ * 64 _targets_ at compile time you are free to replace this with
+ * something that's portable.  For now, _this_ is the portable solution.
+ * (mem, 2004-01-04)
+ */
+
+#include <stddef.h>
+
+#define GLEW_APIENTRY_DEFINED
+#define APIENTRY
+#define GLEWAPI extern
+
+/* <glu.h> */
+#ifndef GLAPI
+#define GLAPI extern
+#endif
+#ifndef GLAPIENTRY
+#define GLAPIENTRY
+#endif
+
+#endif /* _WIN32 */
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+/* ----------------------------- GL_VERSION_1_1 ---------------------------- */
+
+#ifndef GL_VERSION_1_1
+#define GL_VERSION_1_1 1
+
+#if defined(__APPLE__)
+typedef unsigned long GLenum;
+typedef unsigned long GLbitfield;
+typedef unsigned long GLuint;
+typedef long GLint;
+typedef long GLsizei;
+#else
+typedef unsigned int GLenum;
+typedef unsigned int GLbitfield;
+typedef unsigned int GLuint;
+typedef int GLint;
+typedef int GLsizei;
+#endif
+typedef unsigned char GLboolean;
+typedef signed char GLbyte;
+typedef short GLshort;
+typedef unsigned char GLubyte;
+typedef unsigned short GLushort;
+typedef float GLfloat;
+typedef float GLclampf;
+typedef double GLdouble;
+typedef double GLclampd;
+typedef void GLvoid;
+
+#define GL_ACCUM 0x0100
+#define GL_LOAD 0x0101
+#define GL_RETURN 0x0102
+#define GL_MULT 0x0103
+#define GL_ADD 0x0104
+#define GL_NEVER 0x0200
+#define GL_LESS 0x0201
+#define GL_EQUAL 0x0202
+#define GL_LEQUAL 0x0203
+#define GL_GREATER 0x0204
+#define GL_NOTEQUAL 0x0205
+#define GL_GEQUAL 0x0206
+#define GL_ALWAYS 0x0207
+#define GL_CURRENT_BIT 0x00000001
+#define GL_POINT_BIT 0x00000002
+#define GL_LINE_BIT 0x00000004
+#define GL_POLYGON_BIT 0x00000008
+#define GL_POLYGON_STIPPLE_BIT 0x00000010
+#define GL_PIXEL_MODE_BIT 0x00000020
+#define GL_LIGHTING_BIT 0x00000040
+#define GL_FOG_BIT 0x00000080
+#define GL_DEPTH_BUFFER_BIT 0x00000100
+#define GL_ACCUM_BUFFER_BIT 0x00000200
+#define GL_STENCIL_BUFFER_BIT 0x00000400
+#define GL_VIEWPORT_BIT 0x00000800
+#define GL_TRANSFORM_BIT 0x00001000
+#define GL_ENABLE_BIT 0x00002000
+#define GL_COLOR_BUFFER_BIT 0x00004000
+#define GL_HINT_BIT 0x00008000
+#define GL_EVAL_BIT 0x00010000
+#define GL_LIST_BIT 0x00020000
+#define GL_TEXTURE_BIT 0x00040000
+#define GL_SCISSOR_BIT 0x00080000
+#define GL_ALL_ATTRIB_BITS 0x000fffff
+#define GL_POINTS 0x0000
+#define GL_LINES 0x0001
+#define GL_LINE_LOOP 0x0002
+#define GL_LINE_STRIP 0x0003
+#define GL_TRIANGLES 0x0004
+#define GL_TRIANGLE_STRIP 0x0005
+#define GL_TRIANGLE_FAN 0x0006
+#define GL_QUADS 0x0007
+#define GL_QUAD_STRIP 0x0008
+#define GL_POLYGON 0x0009
+#define GL_ZERO 0
+#define GL_ONE 1
+#define GL_SRC_COLOR 0x0300
+#define GL_ONE_MINUS_SRC_COLOR 0x0301
+#define GL_SRC_ALPHA 0x0302
+#define GL_ONE_MINUS_SRC_ALPHA 0x0303
+#define GL_DST_ALPHA 0x0304
+#define GL_ONE_MINUS_DST_ALPHA 0x0305
+#define GL_DST_COLOR 0x0306
+#define GL_ONE_MINUS_DST_COLOR 0x0307
+#define GL_SRC_ALPHA_SATURATE 0x0308
+#define GL_TRUE 1
+#define GL_FALSE 0
+#define GL_CLIP_PLANE0 0x3000
+#define GL_CLIP_PLANE1 0x3001
+#define GL_CLIP_PLANE2 0x3002
+#define GL_CLIP_PLANE3 0x3003
+#define GL_CLIP_PLANE4 0x3004
+#define GL_CLIP_PLANE5 0x3005
+#define GL_BYTE 0x1400
+#define GL_UNSIGNED_BYTE 0x1401
+#define GL_SHORT 0x1402
+#define GL_UNSIGNED_SHORT 0x1403
+#define GL_INT 0x1404
+#define GL_UNSIGNED_INT 0x1405
+#define GL_FLOAT 0x1406
+#define GL_2_BYTES 0x1407
+#define GL_3_BYTES 0x1408
+#define GL_4_BYTES 0x1409
+#define GL_DOUBLE 0x140A
+#define GL_NONE 0
+#define GL_FRONT_LEFT 0x0400
+#define GL_FRONT_RIGHT 0x0401
+#define GL_BACK_LEFT 0x0402
+#define GL_BACK_RIGHT 0x0403
+#define GL_FRONT 0x0404
+#define GL_BACK 0x0405
+#define GL_LEFT 0x0406
+#define GL_RIGHT 0x0407
+#define GL_FRONT_AND_BACK 0x0408
+#define GL_AUX0 0x0409
+#define GL_AUX1 0x040A
+#define GL_AUX2 0x040B
+#define GL_AUX3 0x040C
+#define GL_NO_ERROR 0
+#define GL_INVALID_ENUM 0x0500
+#define GL_INVALID_VALUE 0x0501
+#define GL_INVALID_OPERATION 0x0502
+#define GL_STACK_OVERFLOW 0x0503
+#define GL_STACK_UNDERFLOW 0x0504
+#define GL_OUT_OF_MEMORY 0x0505
+#define GL_2D 0x0600
+#define GL_3D 0x0601
+#define GL_3D_COLOR 0x0602
+#define GL_3D_COLOR_TEXTURE 0x0603
+#define GL_4D_COLOR_TEXTURE 0x0604
+#define GL_PASS_THROUGH_TOKEN 0x0700
+#define GL_POINT_TOKEN 0x0701
+#define GL_LINE_TOKEN 0x0702
+#define GL_POLYGON_TOKEN 0x0703
+#define GL_BITMAP_TOKEN 0x0704
+#define GL_DRAW_PIXEL_TOKEN 0x0705
+#define GL_COPY_PIXEL_TOKEN 0x0706
+#define GL_LINE_RESET_TOKEN 0x0707
+#define GL_EXP 0x0800
+#define GL_EXP2 0x0801
+#define GL_CW 0x0900
+#define GL_CCW 0x0901
+#define GL_COEFF 0x0A00
+#define GL_ORDER 0x0A01
+#define GL_DOMAIN 0x0A02
+#define GL_CURRENT_COLOR 0x0B00
+#define GL_CURRENT_INDEX 0x0B01
+#define GL_CURRENT_NORMAL 0x0B02
+#define GL_CURRENT_TEXTURE_COORDS 0x0B03
+#define GL_CURRENT_RASTER_COLOR 0x0B04
+#define GL_CURRENT_RASTER_INDEX 0x0B05
+#define GL_CURRENT_RASTER_TEXTURE_COORDS 0x0B06
+#define GL_CURRENT_RASTER_POSITION 0x0B07
+#define GL_CURRENT_RASTER_POSITION_VALID 0x0B08
+#define GL_CURRENT_RASTER_DISTANCE 0x0B09
+#define GL_POINT_SMOOTH 0x0B10
+#define GL_POINT_SIZE 0x0B11
+#define GL_POINT_SIZE_RANGE 0x0B12
+#define GL_POINT_SIZE_GRANULARITY 0x0B13
+#define GL_LINE_SMOOTH 0x0B20
+#define GL_LINE_WIDTH 0x0B21
+#define GL_LINE_WIDTH_RANGE 0x0B22
+#define GL_LINE_WIDTH_GRANULARITY 0x0B23
+#define GL_LINE_STIPPLE 0x0B24
+#define GL_LINE_STIPPLE_PATTERN 0x0B25
+#define GL_LINE_STIPPLE_REPEAT 0x0B26
+#define GL_LIST_MODE 0x0B30
+#define GL_MAX_LIST_NESTING 0x0B31
+#define GL_LIST_BASE 0x0B32
+#define GL_LIST_INDEX 0x0B33
+#define GL_POLYGON_MODE 0x0B40
+#define GL_POLYGON_SMOOTH 0x0B41
+#define GL_POLYGON_STIPPLE 0x0B42
+#define GL_EDGE_FLAG 0x0B43
+#define GL_CULL_FACE 0x0B44
+#define GL_CULL_FACE_MODE 0x0B45
+#define GL_FRONT_FACE 0x0B46
+#define GL_LIGHTING 0x0B50
+#define GL_LIGHT_MODEL_LOCAL_VIEWER 0x0B51
+#define GL_LIGHT_MODEL_TWO_SIDE 0x0B52
+#define GL_LIGHT_MODEL_AMBIENT 0x0B53
+#define GL_SHADE_MODEL 0x0B54
+#define GL_COLOR_MATERIAL_FACE 0x0B55
+#define GL_COLOR_MATERIAL_PARAMETER 0x0B56
+#define GL_COLOR_MATERIAL 0x0B57
+#define GL_FOG 0x0B60
+#define GL_FOG_INDEX 0x0B61
+#define GL_FOG_DENSITY 0x0B62
+#define GL_FOG_START 0x0B63
+#define GL_FOG_END 0x0B64
+#define GL_FOG_MODE 0x0B65
+#define GL_FOG_COLOR 0x0B66
+#define GL_DEPTH_RANGE 0x0B70
+#define GL_DEPTH_TEST 0x0B71
+#define GL_DEPTH_WRITEMASK 0x0B72
+#define GL_DEPTH_CLEAR_VALUE 0x0B73
+#define GL_DEPTH_FUNC 0x0B74
+#define GL_ACCUM_CLEAR_VALUE 0x0B80
+#define GL_STENCIL_TEST 0x0B90
+#define GL_STENCIL_CLEAR_VALUE 0x0B91
+#define GL_STENCIL_FUNC 0x0B92
+#define GL_STENCIL_VALUE_MASK 0x0B93
+#define GL_STENCIL_FAIL 0x0B94
+#define GL_STENCIL_PASS_DEPTH_FAIL 0x0B95
+#define GL_STENCIL_PASS_DEPTH_PASS 0x0B96
+#define GL_STENCIL_REF 0x0B97
+#define GL_STENCIL_WRITEMASK 0x0B98
+#define GL_MATRIX_MODE 0x0BA0
+#define GL_NORMALIZE 0x0BA1
+#define GL_VIEWPORT 0x0BA2
+#define GL_MODELVIEW_STACK_DEPTH 0x0BA3
+#define GL_PROJECTION_STACK_DEPTH 0x0BA4
+#define GL_TEXTURE_STACK_DEPTH 0x0BA5
+#define GL_MODELVIEW_MATRIX 0x0BA6
+#define GL_PROJECTION_MATRIX 0x0BA7
+#define GL_TEXTURE_MATRIX 0x0BA8
+#define GL_ATTRIB_STACK_DEPTH 0x0BB0
+#define GL_CLIENT_ATTRIB_STACK_DEPTH 0x0BB1
+#define GL_ALPHA_TEST 0x0BC0
+#define GL_ALPHA_TEST_FUNC 0x0BC1
+#define GL_ALPHA_TEST_REF 0x0BC2
+#define GL_DITHER 0x0BD0
+#define GL_BLEND_DST 0x0BE0
+#define GL_BLEND_SRC 0x0BE1
+#define GL_BLEND 0x0BE2
+#define GL_LOGIC_OP_MODE 0x0BF0
+#define GL_INDEX_LOGIC_OP 0x0BF1
+#define GL_COLOR_LOGIC_OP 0x0BF2
+#define GL_AUX_BUFFERS 0x0C00
+#define GL_DRAW_BUFFER 0x0C01
+#define GL_READ_BUFFER 0x0C02
+#define GL_SCISSOR_BOX 0x0C10
+#define GL_SCISSOR_TEST 0x0C11
+#define GL_INDEX_CLEAR_VALUE 0x0C20
+#define GL_INDEX_WRITEMASK 0x0C21
+#define GL_COLOR_CLEAR_VALUE 0x0C22
+#define GL_COLOR_WRITEMASK 0x0C23
+#define GL_INDEX_MODE 0x0C30
+#define GL_RGBA_MODE 0x0C31
+#define GL_DOUBLEBUFFER 0x0C32
+#define GL_STEREO 0x0C33
+#define GL_RENDER_MODE 0x0C40
+#define GL_PERSPECTIVE_CORRECTION_HINT 0x0C50
+#define GL_POINT_SMOOTH_HINT 0x0C51
+#define GL_LINE_SMOOTH_HINT 0x0C52
+#define GL_POLYGON_SMOOTH_HINT 0x0C53
+#define GL_FOG_HINT 0x0C54
+#define GL_TEXTURE_GEN_S 0x0C60
+#define GL_TEXTURE_GEN_T 0x0C61
+#define GL_TEXTURE_GEN_R 0x0C62
+#define GL_TEXTURE_GEN_Q 0x0C63
+#define GL_PIXEL_MAP_I_TO_I 0x0C70
+#define GL_PIXEL_MAP_S_TO_S 0x0C71
+#define GL_PIXEL_MAP_I_TO_R 0x0C72
+#define GL_PIXEL_MAP_I_TO_G 0x0C73
+#define GL_PIXEL_MAP_I_TO_B 0x0C74
+#define GL_PIXEL_MAP_I_TO_A 0x0C75
+#define GL_PIXEL_MAP_R_TO_R 0x0C76
+#define GL_PIXEL_MAP_G_TO_G 0x0C77
+#define GL_PIXEL_MAP_B_TO_B 0x0C78
+#define GL_PIXEL_MAP_A_TO_A 0x0C79
+#define GL_PIXEL_MAP_I_TO_I_SIZE 0x0CB0
+#define GL_PIXEL_MAP_S_TO_S_SIZE 0x0CB1
+#define GL_PIXEL_MAP_I_TO_R_SIZE 0x0CB2
+#define GL_PIXEL_MAP_I_TO_G_SIZE 0x0CB3
+#define GL_PIXEL_MAP_I_TO_B_SIZE 0x0CB4
+#define GL_PIXEL_MAP_I_TO_A_SIZE 0x0CB5
+#define GL_PIXEL_MAP_R_TO_R_SIZE 0x0CB6
+#define GL_PIXEL_MAP_G_TO_G_SIZE 0x0CB7
+#define GL_PIXEL_MAP_B_TO_B_SIZE 0x0CB8
+#define GL_PIXEL_MAP_A_TO_A_SIZE 0x0CB9
+#define GL_UNPACK_SWAP_BYTES 0x0CF0
+#define GL_UNPACK_LSB_FIRST 0x0CF1
+#define GL_UNPACK_ROW_LENGTH 0x0CF2
+#define GL_UNPACK_SKIP_ROWS 0x0CF3
+#define GL_UNPACK_SKIP_PIXELS 0x0CF4
+#define GL_UNPACK_ALIGNMENT 0x0CF5
+#define GL_PACK_SWAP_BYTES 0x0D00
+#define GL_PACK_LSB_FIRST 0x0D01
+#define GL_PACK_ROW_LENGTH 0x0D02
+#define GL_PACK_SKIP_ROWS 0x0D03
+#define GL_PACK_SKIP_PIXELS 0x0D04
+#define GL_PACK_ALIGNMENT 0x0D05
+#define GL_MAP_COLOR 0x0D10
+#define GL_MAP_STENCIL 0x0D11
+#define GL_INDEX_SHIFT 0x0D12
+#define GL_INDEX_OFFSET 0x0D13
+#define GL_RED_SCALE 0x0D14
+#define GL_RED_BIAS 0x0D15
+#define GL_ZOOM_X 0x0D16
+#define GL_ZOOM_Y 0x0D17
+#define GL_GREEN_SCALE 0x0D18
+#define GL_GREEN_BIAS 0x0D19
+#define GL_BLUE_SCALE 0x0D1A
+#define GL_BLUE_BIAS 0x0D1B
+#define GL_ALPHA_SCALE 0x0D1C
+#define GL_ALPHA_BIAS 0x0D1D
+#define GL_DEPTH_SCALE 0x0D1E
+#define GL_DEPTH_BIAS 0x0D1F
+#define GL_MAX_EVAL_ORDER 0x0D30
+#define GL_MAX_LIGHTS 0x0D31
+#define GL_MAX_CLIP_PLANES 0x0D32
+#define GL_MAX_TEXTURE_SIZE 0x0D33
+#define GL_MAX_PIXEL_MAP_TABLE 0x0D34
+#define GL_MAX_ATTRIB_STACK_DEPTH 0x0D35
+#define GL_MAX_MODELVIEW_STACK_DEPTH 0x0D36
+#define GL_MAX_NAME_STACK_DEPTH 0x0D37
+#define GL_MAX_PROJECTION_STACK_DEPTH 0x0D38
+#define GL_MAX_TEXTURE_STACK_DEPTH 0x0D39
+#define GL_MAX_VIEWPORT_DIMS 0x0D3A
+#define GL_MAX_CLIENT_ATTRIB_STACK_DEPTH 0x0D3B
+#define GL_SUBPIXEL_BITS 0x0D50
+#define GL_INDEX_BITS 0x0D51
+#define GL_RED_BITS 0x0D52
+#define GL_GREEN_BITS 0x0D53
+#define GL_BLUE_BITS 0x0D54
+#define GL_ALPHA_BITS 0x0D55
+#define GL_DEPTH_BITS 0x0D56
+#define GL_STENCIL_BITS 0x0D57
+#define GL_ACCUM_RED_BITS 0x0D58
+#define GL_ACCUM_GREEN_BITS 0x0D59
+#define GL_ACCUM_BLUE_BITS 0x0D5A
+#define GL_ACCUM_ALPHA_BITS 0x0D5B
+#define GL_NAME_STACK_DEPTH 0x0D70
+#define GL_AUTO_NORMAL 0x0D80
+#define GL_MAP1_COLOR_4 0x0D90
+#define GL_MAP1_INDEX 0x0D91
+#define GL_MAP1_NORMAL 0x0D92
+#define GL_MAP1_TEXTURE_COORD_1 0x0D93
+#define GL_MAP1_TEXTURE_COORD_2 0x0D94
+#define GL_MAP1_TEXTURE_COORD_3 0x0D95
+#define GL_MAP1_TEXTURE_COORD_4 0x0D96
+#define GL_MAP1_VERTEX_3 0x0D97
+#define GL_MAP1_VERTEX_4 0x0D98
+#define GL_MAP2_COLOR_4 0x0DB0
+#define GL_MAP2_INDEX 0x0DB1
+#define GL_MAP2_NORMAL 0x0DB2
+#define GL_MAP2_TEXTURE_COORD_1 0x0DB3
+#define GL_MAP2_TEXTURE_COORD_2 0x0DB4
+#define GL_MAP2_TEXTURE_COORD_3 0x0DB5
+#define GL_MAP2_TEXTURE_COORD_4 0x0DB6
+#define GL_MAP2_VERTEX_3 0x0DB7
+#define GL_MAP2_VERTEX_4 0x0DB8
+#define GL_MAP1_GRID_DOMAIN 0x0DD0
+#define GL_MAP1_GRID_SEGMENTS 0x0DD1
+#define GL_MAP2_GRID_DOMAIN 0x0DD2
+#define GL_MAP2_GRID_SEGMENTS 0x0DD3
+#define GL_TEXTURE_1D 0x0DE0
+#define GL_TEXTURE_2D 0x0DE1
+#define GL_FEEDBACK_BUFFER_POINTER 0x0DF0
+#define GL_FEEDBACK_BUFFER_SIZE 0x0DF1
+#define GL_FEEDBACK_BUFFER_TYPE 0x0DF2
+#define GL_SELECTION_BUFFER_POINTER 0x0DF3
+#define GL_SELECTION_BUFFER_SIZE 0x0DF4
+#define GL_TEXTURE_WIDTH 0x1000
+#define GL_TEXTURE_HEIGHT 0x1001
+#define GL_TEXTURE_INTERNAL_FORMAT 0x1003
+#define GL_TEXTURE_BORDER_COLOR 0x1004
+#define GL_TEXTURE_BORDER 0x1005
+#define GL_DONT_CARE 0x1100
+#define GL_FASTEST 0x1101
+#define GL_NICEST 0x1102
+#define GL_LIGHT0 0x4000
+#define GL_LIGHT1 0x4001
+#define GL_LIGHT2 0x4002
+#define GL_LIGHT3 0x4003
+#define GL_LIGHT4 0x4004
+#define GL_LIGHT5 0x4005
+#define GL_LIGHT6 0x4006
+#define GL_LIGHT7 0x4007
+#define GL_AMBIENT 0x1200
+#define GL_DIFFUSE 0x1201
+#define GL_SPECULAR 0x1202
+#define GL_POSITION 0x1203
+#define GL_SPOT_DIRECTION 0x1204
+#define GL_SPOT_EXPONENT 0x1205
+#define GL_SPOT_CUTOFF 0x1206
+#define GL_CONSTANT_ATTENUATION 0x1207
+#define GL_LINEAR_ATTENUATION 0x1208
+#define GL_QUADRATIC_ATTENUATION 0x1209
+#define GL_COMPILE 0x1300
+#define GL_COMPILE_AND_EXECUTE 0x1301
+#define GL_CLEAR 0x1500
+#define GL_AND 0x1501
+#define GL_AND_REVERSE 0x1502
+#define GL_COPY 0x1503
+#define GL_AND_INVERTED 0x1504
+#define GL_NOOP 0x1505
+#define GL_XOR 0x1506
+#define GL_OR 0x1507
+#define GL_NOR 0x1508
+#define GL_EQUIV 0x1509
+#define GL_INVERT 0x150A
+#define GL_OR_REVERSE 0x150B
+#define GL_COPY_INVERTED 0x150C
+#define GL_OR_INVERTED 0x150D
+#define GL_NAND 0x150E
+#define GL_SET 0x150F
+#define GL_EMISSION 0x1600
+#define GL_SHININESS 0x1601
+#define GL_AMBIENT_AND_DIFFUSE 0x1602
+#define GL_COLOR_INDEXES 0x1603
+#define GL_MODELVIEW 0x1700
+#define GL_PROJECTION 0x1701
+#define GL_TEXTURE 0x1702
+#define GL_COLOR 0x1800
+#define GL_DEPTH 0x1801
+#define GL_STENCIL 0x1802
+#define GL_COLOR_INDEX 0x1900
+#define GL_STENCIL_INDEX 0x1901
+#define GL_DEPTH_COMPONENT 0x1902
+#define GL_RED 0x1903
+#define GL_GREEN 0x1904
+#define GL_BLUE 0x1905
+#define GL_ALPHA 0x1906
+#define GL_RGB 0x1907
+#define GL_RGBA 0x1908
+#define GL_LUMINANCE 0x1909
+#define GL_LUMINANCE_ALPHA 0x190A
+#define GL_BITMAP 0x1A00
+#define GL_POINT 0x1B00
+#define GL_LINE 0x1B01
+#define GL_FILL 0x1B02
+#define GL_RENDER 0x1C00
+#define GL_FEEDBACK 0x1C01
+#define GL_SELECT 0x1C02
+#define GL_FLAT 0x1D00
+#define GL_SMOOTH 0x1D01
+#define GL_KEEP 0x1E00
+#define GL_REPLACE 0x1E01
+#define GL_INCR 0x1E02
+#define GL_DECR 0x1E03
+#define GL_VENDOR 0x1F00
+#define GL_RENDERER 0x1F01
+#define GL_VERSION 0x1F02
+#define GL_EXTENSIONS 0x1F03
+#define GL_S 0x2000
+#define GL_T 0x2001
+#define GL_R 0x2002
+#define GL_Q 0x2003
+#define GL_MODULATE 0x2100
+#define GL_DECAL 0x2101
+#define GL_TEXTURE_ENV_MODE 0x2200
+#define GL_TEXTURE_ENV_COLOR 0x2201
+#define GL_TEXTURE_ENV 0x2300
+#define GL_EYE_LINEAR 0x2400
+#define GL_OBJECT_LINEAR 0x2401
+#define GL_SPHERE_MAP 0x2402
+#define GL_TEXTURE_GEN_MODE 0x2500
+#define GL_OBJECT_PLANE 0x2501
+#define GL_EYE_PLANE 0x2502
+#define GL_NEAREST 0x2600
+#define GL_LINEAR 0x2601
+#define GL_NEAREST_MIPMAP_NEAREST 0x2700
+#define GL_LINEAR_MIPMAP_NEAREST 0x2701
+#define GL_NEAREST_MIPMAP_LINEAR 0x2702
+#define GL_LINEAR_MIPMAP_LINEAR 0x2703
+#define GL_TEXTURE_MAG_FILTER 0x2800
+#define GL_TEXTURE_MIN_FILTER 0x2801
+#define GL_TEXTURE_WRAP_S 0x2802
+#define GL_TEXTURE_WRAP_T 0x2803
+#define GL_CLAMP 0x2900
+#define GL_REPEAT 0x2901
+#define GL_CLIENT_PIXEL_STORE_BIT 0x00000001
+#define GL_CLIENT_VERTEX_ARRAY_BIT 0x00000002
+#define GL_CLIENT_ALL_ATTRIB_BITS 0xffffffff
+#define GL_POLYGON_OFFSET_FACTOR 0x8038
+#define GL_POLYGON_OFFSET_UNITS 0x2A00
+#define GL_POLYGON_OFFSET_POINT 0x2A01
+#define GL_POLYGON_OFFSET_LINE 0x2A02
+#define GL_POLYGON_OFFSET_FILL 0x8037
+#define GL_ALPHA4 0x803B
+#define GL_ALPHA8 0x803C
+#define GL_ALPHA12 0x803D
+#define GL_ALPHA16 0x803E
+#define GL_LUMINANCE4 0x803F
+#define GL_LUMINANCE8 0x8040
+#define GL_LUMINANCE12 0x8041
+#define GL_LUMINANCE16 0x8042
+#define GL_LUMINANCE4_ALPHA4 0x8043
+#define GL_LUMINANCE6_ALPHA2 0x8044
+#define GL_LUMINANCE8_ALPHA8 0x8045
+#define GL_LUMINANCE12_ALPHA4 0x8046
+#define GL_LUMINANCE12_ALPHA12 0x8047
+#define GL_LUMINANCE16_ALPHA16 0x8048
+#define GL_INTENSITY 0x8049
+#define GL_INTENSITY4 0x804A
+#define GL_INTENSITY8 0x804B
+#define GL_INTENSITY12 0x804C
+#define GL_INTENSITY16 0x804D
+#define GL_R3_G3_B2 0x2A10
+#define GL_RGB4 0x804F
+#define GL_RGB5 0x8050
+#define GL_RGB8 0x8051
+#define GL_RGB10 0x8052
+#define GL_RGB12 0x8053
+#define GL_RGB16 0x8054
+#define GL_RGBA2 0x8055
+#define GL_RGBA4 0x8056
+#define GL_RGB5_A1 0x8057
+#define GL_RGBA8 0x8058
+#define GL_RGB10_A2 0x8059
+#define GL_RGBA12 0x805A
+#define GL_RGBA16 0x805B
+#define GL_TEXTURE_RED_SIZE 0x805C
+#define GL_TEXTURE_GREEN_SIZE 0x805D
+#define GL_TEXTURE_BLUE_SIZE 0x805E
+#define GL_TEXTURE_ALPHA_SIZE 0x805F
+#define GL_TEXTURE_LUMINANCE_SIZE 0x8060
+#define GL_TEXTURE_INTENSITY_SIZE 0x8061
+#define GL_PROXY_TEXTURE_1D 0x8063
+#define GL_PROXY_TEXTURE_2D 0x8064
+#define GL_TEXTURE_PRIORITY 0x8066
+#define GL_TEXTURE_RESIDENT 0x8067
+#define GL_TEXTURE_BINDING_1D 0x8068
+#define GL_TEXTURE_BINDING_2D 0x8069
+#define GL_VERTEX_ARRAY 0x8074
+#define GL_NORMAL_ARRAY 0x8075
+#define GL_COLOR_ARRAY 0x8076
+#define GL_INDEX_ARRAY 0x8077
+#define GL_TEXTURE_COORD_ARRAY 0x8078
+#define GL_EDGE_FLAG_ARRAY 0x8079
+#define GL_VERTEX_ARRAY_SIZE 0x807A
+#define GL_VERTEX_ARRAY_TYPE 0x807B
+#define GL_VERTEX_ARRAY_STRIDE 0x807C
+#define GL_NORMAL_ARRAY_TYPE 0x807E
+#define GL_NORMAL_ARRAY_STRIDE 0x807F
+#define GL_COLOR_ARRAY_SIZE 0x8081
+#define GL_COLOR_ARRAY_TYPE 0x8082
+#define GL_COLOR_ARRAY_STRIDE 0x8083
+#define GL_INDEX_ARRAY_TYPE 0x8085
+#define GL_INDEX_ARRAY_STRIDE 0x8086
+#define GL_TEXTURE_COORD_ARRAY_SIZE 0x8088
+#define GL_TEXTURE_COORD_ARRAY_TYPE 0x8089
+#define GL_TEXTURE_COORD_ARRAY_STRIDE 0x808A
+#define GL_EDGE_FLAG_ARRAY_STRIDE 0x808C
+#define GL_VERTEX_ARRAY_POINTER 0x808E
+#define GL_NORMAL_ARRAY_POINTER 0x808F
+#define GL_COLOR_ARRAY_POINTER 0x8090
+#define GL_INDEX_ARRAY_POINTER 0x8091
+#define GL_TEXTURE_COORD_ARRAY_POINTER 0x8092
+#define GL_EDGE_FLAG_ARRAY_POINTER 0x8093
+#define GL_V2F 0x2A20
+#define GL_V3F 0x2A21
+#define GL_C4UB_V2F 0x2A22
+#define GL_C4UB_V3F 0x2A23
+#define GL_C3F_V3F 0x2A24
+#define GL_N3F_V3F 0x2A25
+#define GL_C4F_N3F_V3F 0x2A26
+#define GL_T2F_V3F 0x2A27
+#define GL_T4F_V4F 0x2A28
+#define GL_T2F_C4UB_V3F 0x2A29
+#define GL_T2F_C3F_V3F 0x2A2A
+#define GL_T2F_N3F_V3F 0x2A2B
+#define GL_T2F_C4F_N3F_V3F 0x2A2C
+#define GL_T4F_C4F_N3F_V4F 0x2A2D
+#define GL_LOGIC_OP GL_INDEX_LOGIC_OP
+#define GL_TEXTURE_COMPONENTS GL_TEXTURE_INTERNAL_FORMAT
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+
+GLAPI void GLAPIENTRY glAccum (GLenum op, GLfloat value);
+GLAPI void GLAPIENTRY glAlphaFunc (GLenum func, GLclampf ref);
+GLAPI GLboolean GLAPIENTRY glAreTexturesResident (GLsizei n, const GLuint *textures, GLboolean *residences);
+GLAPI void GLAPIENTRY glArrayElement (GLint i);
+GLAPI void GLAPIENTRY glBegin (GLenum mode);
+GLAPI void GLAPIENTRY glBindTexture (GLenum target, GLuint texture);
+GLAPI void GLAPIENTRY glBitmap (GLsizei width, GLsizei height, GLfloat xorig, GLfloat yorig, GLfloat xmove, GLfloat ymove, const GLubyte *bitmap);
+GLAPI void GLAPIENTRY glBlendFunc (GLenum sfactor, GLenum dfactor);
+GLAPI void GLAPIENTRY glCallList (GLuint list);
+GLAPI void GLAPIENTRY glCallLists (GLsizei n, GLenum type, const GLvoid *lists);
+GLAPI void GLAPIENTRY glClear (GLbitfield mask);
+GLAPI void GLAPIENTRY glClearAccum (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glClearColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+GLAPI void GLAPIENTRY glClearDepth (GLclampd depth);
+GLAPI void GLAPIENTRY glClearIndex (GLfloat c);
+GLAPI void GLAPIENTRY glClearStencil (GLint s);
+GLAPI void GLAPIENTRY glClipPlane (GLenum plane, const GLdouble *equation);
+GLAPI void GLAPIENTRY glColor3b (GLbyte red, GLbyte green, GLbyte blue);
+GLAPI void GLAPIENTRY glColor3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor3d (GLdouble red, GLdouble green, GLdouble blue);
+GLAPI void GLAPIENTRY glColor3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor3f (GLfloat red, GLfloat green, GLfloat blue);
+GLAPI void GLAPIENTRY glColor3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor3i (GLint red, GLint green, GLint blue);
+GLAPI void GLAPIENTRY glColor3iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor3s (GLshort red, GLshort green, GLshort blue);
+GLAPI void GLAPIENTRY glColor3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor3ub (GLubyte red, GLubyte green, GLubyte blue);
+GLAPI void GLAPIENTRY glColor3ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor3ui (GLuint red, GLuint green, GLuint blue);
+GLAPI void GLAPIENTRY glColor3uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor3us (GLushort red, GLushort green, GLushort blue);
+GLAPI void GLAPIENTRY glColor3usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColor4b (GLbyte red, GLbyte green, GLbyte blue, GLbyte alpha);
+GLAPI void GLAPIENTRY glColor4bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glColor4d (GLdouble red, GLdouble green, GLdouble blue, GLdouble alpha);
+GLAPI void GLAPIENTRY glColor4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glColor4f (GLfloat red, GLfloat green, GLfloat blue, GLfloat alpha);
+GLAPI void GLAPIENTRY glColor4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glColor4i (GLint red, GLint green, GLint blue, GLint alpha);
+GLAPI void GLAPIENTRY glColor4iv (const GLint *v);
+GLAPI void GLAPIENTRY glColor4s (GLshort red, GLshort green, GLshort blue, GLshort alpha);
+GLAPI void GLAPIENTRY glColor4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glColor4ub (GLubyte red, GLubyte green, GLubyte blue, GLubyte alpha);
+GLAPI void GLAPIENTRY glColor4ubv (const GLubyte *v);
+GLAPI void GLAPIENTRY glColor4ui (GLuint red, GLuint green, GLuint blue, GLuint alpha);
+GLAPI void GLAPIENTRY glColor4uiv (const GLuint *v);
+GLAPI void GLAPIENTRY glColor4us (GLushort red, GLushort green, GLushort blue, GLushort alpha);
+GLAPI void GLAPIENTRY glColor4usv (const GLushort *v);
+GLAPI void GLAPIENTRY glColorMask (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
+GLAPI void GLAPIENTRY glColorMaterial (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glColorPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glCopyPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum type);
+GLAPI void GLAPIENTRY glCopyTexImage1D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLint border);
+GLAPI void GLAPIENTRY glCopyTexImage2D (GLenum target, GLint level, GLenum internalFormat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+GLAPI void GLAPIENTRY glCopyTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+GLAPI void GLAPIENTRY glCopyTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glCullFace (GLenum mode);
+GLAPI void GLAPIENTRY glDeleteLists (GLuint list, GLsizei range);
+GLAPI void GLAPIENTRY glDeleteTextures (GLsizei n, const GLuint *textures);
+GLAPI void GLAPIENTRY glDepthFunc (GLenum func);
+GLAPI void GLAPIENTRY glDepthMask (GLboolean flag);
+GLAPI void GLAPIENTRY glDepthRange (GLclampd zNear, GLclampd zFar);
+GLAPI void GLAPIENTRY glDisable (GLenum cap);
+GLAPI void GLAPIENTRY glDisableClientState (GLenum array);
+GLAPI void GLAPIENTRY glDrawArrays (GLenum mode, GLint first, GLsizei count);
+GLAPI void GLAPIENTRY glDrawBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glDrawElements (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices);
+GLAPI void GLAPIENTRY glDrawPixels (GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glEdgeFlag (GLboolean flag);
+GLAPI void GLAPIENTRY glEdgeFlagPointer (GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glEdgeFlagv (const GLboolean *flag);
+GLAPI void GLAPIENTRY glEnable (GLenum cap);
+GLAPI void GLAPIENTRY glEnableClientState (GLenum array);
+GLAPI void GLAPIENTRY glEnd (void);
+GLAPI void GLAPIENTRY glEndList (void);
+GLAPI void GLAPIENTRY glEvalCoord1d (GLdouble u);
+GLAPI void GLAPIENTRY glEvalCoord1dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord1f (GLfloat u);
+GLAPI void GLAPIENTRY glEvalCoord1fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalCoord2d (GLdouble u, GLdouble v);
+GLAPI void GLAPIENTRY glEvalCoord2dv (const GLdouble *u);
+GLAPI void GLAPIENTRY glEvalCoord2f (GLfloat u, GLfloat v);
+GLAPI void GLAPIENTRY glEvalCoord2fv (const GLfloat *u);
+GLAPI void GLAPIENTRY glEvalMesh1 (GLenum mode, GLint i1, GLint i2);
+GLAPI void GLAPIENTRY glEvalMesh2 (GLenum mode, GLint i1, GLint i2, GLint j1, GLint j2);
+GLAPI void GLAPIENTRY glEvalPoint1 (GLint i);
+GLAPI void GLAPIENTRY glEvalPoint2 (GLint i, GLint j);
+GLAPI void GLAPIENTRY glFeedbackBuffer (GLsizei size, GLenum type, GLfloat *buffer);
+GLAPI void GLAPIENTRY glFinish (void);
+GLAPI void GLAPIENTRY glFlush (void);
+GLAPI void GLAPIENTRY glFogf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glFogfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glFogi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glFogiv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glFrontFace (GLenum mode);
+GLAPI void GLAPIENTRY glFrustum (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI GLuint GLAPIENTRY glGenLists (GLsizei range);
+GLAPI void GLAPIENTRY glGenTextures (GLsizei n, GLuint *textures);
+GLAPI void GLAPIENTRY glGetBooleanv (GLenum pname, GLboolean *params);
+GLAPI void GLAPIENTRY glGetClipPlane (GLenum plane, GLdouble *equation);
+GLAPI void GLAPIENTRY glGetDoublev (GLenum pname, GLdouble *params);
+GLAPI GLenum GLAPIENTRY glGetError (void);
+GLAPI void GLAPIENTRY glGetFloatv (GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetIntegerv (GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetLightfv (GLenum light, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetLightiv (GLenum light, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetMapdv (GLenum target, GLenum query, GLdouble *v);
+GLAPI void GLAPIENTRY glGetMapfv (GLenum target, GLenum query, GLfloat *v);
+GLAPI void GLAPIENTRY glGetMapiv (GLenum target, GLenum query, GLint *v);
+GLAPI void GLAPIENTRY glGetMaterialfv (GLenum face, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetMaterialiv (GLenum face, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetPixelMapfv (GLenum map, GLfloat *values);
+GLAPI void GLAPIENTRY glGetPixelMapuiv (GLenum map, GLuint *values);
+GLAPI void GLAPIENTRY glGetPixelMapusv (GLenum map, GLushort *values);
+GLAPI void GLAPIENTRY glGetPointerv (GLenum pname, GLvoid* *params);
+GLAPI void GLAPIENTRY glGetPolygonStipple (GLubyte *mask);
+GLAPI const GLubyte * GLAPIENTRY glGetString (GLenum name);
+GLAPI void GLAPIENTRY glGetTexEnvfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexEnviv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexGendv (GLenum coord, GLenum pname, GLdouble *params);
+GLAPI void GLAPIENTRY glGetTexGenfv (GLenum coord, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexGeniv (GLenum coord, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexImage (GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels);
+GLAPI void GLAPIENTRY glGetTexLevelParameterfv (GLenum target, GLint level, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexLevelParameteriv (GLenum target, GLint level, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glGetTexParameterfv (GLenum target, GLenum pname, GLfloat *params);
+GLAPI void GLAPIENTRY glGetTexParameteriv (GLenum target, GLenum pname, GLint *params);
+GLAPI void GLAPIENTRY glHint (GLenum target, GLenum mode);
+GLAPI void GLAPIENTRY glIndexMask (GLuint mask);
+GLAPI void GLAPIENTRY glIndexPointer (GLenum type, GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glIndexd (GLdouble c);
+GLAPI void GLAPIENTRY glIndexdv (const GLdouble *c);
+GLAPI void GLAPIENTRY glIndexf (GLfloat c);
+GLAPI void GLAPIENTRY glIndexfv (const GLfloat *c);
+GLAPI void GLAPIENTRY glIndexi (GLint c);
+GLAPI void GLAPIENTRY glIndexiv (const GLint *c);
+GLAPI void GLAPIENTRY glIndexs (GLshort c);
+GLAPI void GLAPIENTRY glIndexsv (const GLshort *c);
+GLAPI void GLAPIENTRY glIndexub (GLubyte c);
+GLAPI void GLAPIENTRY glIndexubv (const GLubyte *c);
+GLAPI void GLAPIENTRY glInitNames (void);
+GLAPI void GLAPIENTRY glInterleavedArrays (GLenum format, GLsizei stride, const GLvoid *pointer);
+GLAPI GLboolean GLAPIENTRY glIsEnabled (GLenum cap);
+GLAPI GLboolean GLAPIENTRY glIsList (GLuint list);
+GLAPI GLboolean GLAPIENTRY glIsTexture (GLuint texture);
+GLAPI void GLAPIENTRY glLightModelf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightModelfv (GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLightModeli (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightModeliv (GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLightf (GLenum light, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glLightfv (GLenum light, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glLighti (GLenum light, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glLightiv (GLenum light, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glLineStipple (GLint factor, GLushort pattern);
+GLAPI void GLAPIENTRY glLineWidth (GLfloat width);
+GLAPI void GLAPIENTRY glListBase (GLuint base);
+GLAPI void GLAPIENTRY glLoadIdentity (void);
+GLAPI void GLAPIENTRY glLoadMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glLoadMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glLoadName (GLuint name);
+GLAPI void GLAPIENTRY glLogicOp (GLenum opcode);
+GLAPI void GLAPIENTRY glMap1d (GLenum target, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap1f (GLenum target, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points);
+GLAPI void GLAPIENTRY glMap2d (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points);
+GLAPI void GLAPIENTRY glMap2f (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points);
+GLAPI void GLAPIENTRY glMapGrid1d (GLint un, GLdouble u1, GLdouble u2);
+GLAPI void GLAPIENTRY glMapGrid1f (GLint un, GLfloat u1, GLfloat u2);
+GLAPI void GLAPIENTRY glMapGrid2d (GLint un, GLdouble u1, GLdouble u2, GLint vn, GLdouble v1, GLdouble v2);
+GLAPI void GLAPIENTRY glMapGrid2f (GLint un, GLfloat u1, GLfloat u2, GLint vn, GLfloat v1, GLfloat v2);
+GLAPI void GLAPIENTRY glMaterialf (GLenum face, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glMaterialfv (GLenum face, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glMateriali (GLenum face, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glMaterialiv (GLenum face, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glMatrixMode (GLenum mode);
+GLAPI void GLAPIENTRY glMultMatrixd (const GLdouble *m);
+GLAPI void GLAPIENTRY glMultMatrixf (const GLfloat *m);
+GLAPI void GLAPIENTRY glNewList (GLuint list, GLenum mode);
+GLAPI void GLAPIENTRY glNormal3b (GLbyte nx, GLbyte ny, GLbyte nz);
+GLAPI void GLAPIENTRY glNormal3bv (const GLbyte *v);
+GLAPI void GLAPIENTRY glNormal3d (GLdouble nx, GLdouble ny, GLdouble nz);
+GLAPI void GLAPIENTRY glNormal3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glNormal3f (GLfloat nx, GLfloat ny, GLfloat nz);
+GLAPI void GLAPIENTRY glNormal3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glNormal3i (GLint nx, GLint ny, GLint nz);
+GLAPI void GLAPIENTRY glNormal3iv (const GLint *v);
+GLAPI void GLAPIENTRY glNormal3s (GLshort nx, GLshort ny, GLshort nz);
+GLAPI void GLAPIENTRY glNormal3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glNormalPointer (GLenum type, GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glOrtho (GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar);
+GLAPI void GLAPIENTRY glPassThrough (GLfloat token);
+GLAPI void GLAPIENTRY glPixelMapfv (GLenum map, GLsizei mapsize, const GLfloat *values);
+GLAPI void GLAPIENTRY glPixelMapuiv (GLenum map, GLsizei mapsize, const GLuint *values);
+GLAPI void GLAPIENTRY glPixelMapusv (GLenum map, GLsizei mapsize, const GLushort *values);
+GLAPI void GLAPIENTRY glPixelStoref (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelStorei (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelTransferf (GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glPixelTransferi (GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glPixelZoom (GLfloat xfactor, GLfloat yfactor);
+GLAPI void GLAPIENTRY glPointSize (GLfloat size);
+GLAPI void GLAPIENTRY glPolygonMode (GLenum face, GLenum mode);
+GLAPI void GLAPIENTRY glPolygonOffset (GLfloat factor, GLfloat units);
+GLAPI void GLAPIENTRY glPolygonStipple (const GLubyte *mask);
+GLAPI void GLAPIENTRY glPopAttrib (void);
+GLAPI void GLAPIENTRY glPopClientAttrib (void);
+GLAPI void GLAPIENTRY glPopMatrix (void);
+GLAPI void GLAPIENTRY glPopName (void);
+GLAPI void GLAPIENTRY glPrioritizeTextures (GLsizei n, const GLuint *textures, const GLclampf *priorities);
+GLAPI void GLAPIENTRY glPushAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushClientAttrib (GLbitfield mask);
+GLAPI void GLAPIENTRY glPushMatrix (void);
+GLAPI void GLAPIENTRY glPushName (GLuint name);
+GLAPI void GLAPIENTRY glRasterPos2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glRasterPos2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glRasterPos2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glRasterPos2iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glRasterPos2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRasterPos3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glRasterPos3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glRasterPos3iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glRasterPos3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glRasterPos4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glRasterPos4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glRasterPos4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glRasterPos4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glRasterPos4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glRasterPos4iv (const GLint *v);
+GLAPI void GLAPIENTRY glRasterPos4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glRasterPos4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glReadBuffer (GLenum mode);
+GLAPI void GLAPIENTRY glReadPixels (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLvoid *pixels);
+GLAPI void GLAPIENTRY glRectd (GLdouble x1, GLdouble y1, GLdouble x2, GLdouble y2);
+GLAPI void GLAPIENTRY glRectdv (const GLdouble *v1, const GLdouble *v2);
+GLAPI void GLAPIENTRY glRectf (GLfloat x1, GLfloat y1, GLfloat x2, GLfloat y2);
+GLAPI void GLAPIENTRY glRectfv (const GLfloat *v1, const GLfloat *v2);
+GLAPI void GLAPIENTRY glRecti (GLint x1, GLint y1, GLint x2, GLint y2);
+GLAPI void GLAPIENTRY glRectiv (const GLint *v1, const GLint *v2);
+GLAPI void GLAPIENTRY glRects (GLshort x1, GLshort y1, GLshort x2, GLshort y2);
+GLAPI void GLAPIENTRY glRectsv (const GLshort *v1, const GLshort *v2);
+GLAPI GLint GLAPIENTRY glRenderMode (GLenum mode);
+GLAPI void GLAPIENTRY glRotated (GLdouble angle, GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glRotatef (GLfloat angle, GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScaled (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glScalef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glScissor (GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void GLAPIENTRY glSelectBuffer (GLsizei size, GLuint *buffer);
+GLAPI void GLAPIENTRY glShadeModel (GLenum mode);
+GLAPI void GLAPIENTRY glStencilFunc (GLenum func, GLint ref, GLuint mask);
+GLAPI void GLAPIENTRY glStencilMask (GLuint mask);
+GLAPI void GLAPIENTRY glStencilOp (GLenum fail, GLenum zfail, GLenum zpass);
+GLAPI void GLAPIENTRY glTexCoord1d (GLdouble s);
+GLAPI void GLAPIENTRY glTexCoord1dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord1f (GLfloat s);
+GLAPI void GLAPIENTRY glTexCoord1fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord1i (GLint s);
+GLAPI void GLAPIENTRY glTexCoord1iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord1s (GLshort s);
+GLAPI void GLAPIENTRY glTexCoord1sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord2d (GLdouble s, GLdouble t);
+GLAPI void GLAPIENTRY glTexCoord2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord2f (GLfloat s, GLfloat t);
+GLAPI void GLAPIENTRY glTexCoord2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord2i (GLint s, GLint t);
+GLAPI void GLAPIENTRY glTexCoord2iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord2s (GLshort s, GLshort t);
+GLAPI void GLAPIENTRY glTexCoord2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord3d (GLdouble s, GLdouble t, GLdouble r);
+GLAPI void GLAPIENTRY glTexCoord3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord3f (GLfloat s, GLfloat t, GLfloat r);
+GLAPI void GLAPIENTRY glTexCoord3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord3i (GLint s, GLint t, GLint r);
+GLAPI void GLAPIENTRY glTexCoord3iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord3s (GLshort s, GLshort t, GLshort r);
+GLAPI void GLAPIENTRY glTexCoord3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoord4d (GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+GLAPI void GLAPIENTRY glTexCoord4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glTexCoord4f (GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+GLAPI void GLAPIENTRY glTexCoord4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glTexCoord4i (GLint s, GLint t, GLint r, GLint q);
+GLAPI void GLAPIENTRY glTexCoord4iv (const GLint *v);
+GLAPI void GLAPIENTRY glTexCoord4s (GLshort s, GLshort t, GLshort r, GLshort q);
+GLAPI void GLAPIENTRY glTexCoord4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glTexCoordPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glTexEnvf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexEnvfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexEnvi (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexEnviv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexGend (GLenum coord, GLenum pname, GLdouble param);
+GLAPI void GLAPIENTRY glTexGendv (GLenum coord, GLenum pname, const GLdouble *params);
+GLAPI void GLAPIENTRY glTexGenf (GLenum coord, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexGenfv (GLenum coord, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexGeni (GLenum coord, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexGeniv (GLenum coord, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexImage1D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glTexImage2D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glTexParameterf (GLenum target, GLenum pname, GLfloat param);
+GLAPI void GLAPIENTRY glTexParameterfv (GLenum target, GLenum pname, const GLfloat *params);
+GLAPI void GLAPIENTRY glTexParameteri (GLenum target, GLenum pname, GLint param);
+GLAPI void GLAPIENTRY glTexParameteriv (GLenum target, GLenum pname, const GLint *params);
+GLAPI void GLAPIENTRY glTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
+GLAPI void GLAPIENTRY glTranslated (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glTranslatef (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex2d (GLdouble x, GLdouble y);
+GLAPI void GLAPIENTRY glVertex2dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex2f (GLfloat x, GLfloat y);
+GLAPI void GLAPIENTRY glVertex2fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex2i (GLint x, GLint y);
+GLAPI void GLAPIENTRY glVertex2iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex2s (GLshort x, GLshort y);
+GLAPI void GLAPIENTRY glVertex2sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex3d (GLdouble x, GLdouble y, GLdouble z);
+GLAPI void GLAPIENTRY glVertex3dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex3f (GLfloat x, GLfloat y, GLfloat z);
+GLAPI void GLAPIENTRY glVertex3fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex3i (GLint x, GLint y, GLint z);
+GLAPI void GLAPIENTRY glVertex3iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex3s (GLshort x, GLshort y, GLshort z);
+GLAPI void GLAPIENTRY glVertex3sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertex4d (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+GLAPI void GLAPIENTRY glVertex4dv (const GLdouble *v);
+GLAPI void GLAPIENTRY glVertex4f (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+GLAPI void GLAPIENTRY glVertex4fv (const GLfloat *v);
+GLAPI void GLAPIENTRY glVertex4i (GLint x, GLint y, GLint z, GLint w);
+GLAPI void GLAPIENTRY glVertex4iv (const GLint *v);
+GLAPI void GLAPIENTRY glVertex4s (GLshort x, GLshort y, GLshort z, GLshort w);
+GLAPI void GLAPIENTRY glVertex4sv (const GLshort *v);
+GLAPI void GLAPIENTRY glVertexPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
+GLAPI void GLAPIENTRY glViewport (GLint x, GLint y, GLsizei width, GLsizei height);
+
+#define GLEW_VERSION_1_1 GLEW_GET_VAR(__GLEW_VERSION_1_1)
+
+#endif /* GL_VERSION_1_1 */
+
+/* ---------------------------------- GLU ---------------------------------- */
+
+/* this is where we can safely include GLU */
+#if defined(__APPLE__) && defined(__MACH__)
+#include <OpenGL/glu.h>
+#else
+#include <GL/glu.h>
+#endif
+
+/* ----------------------------- GL_VERSION_1_2 ---------------------------- */
+
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+
+#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12
+#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13
+#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22
+#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23
+#define GL_UNSIGNED_BYTE_3_3_2 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2 0x8036
+#define GL_RESCALE_NORMAL 0x803A
+#define GL_TEXTURE_BINDING_3D 0x806A
+#define GL_PACK_SKIP_IMAGES 0x806B
+#define GL_PACK_IMAGE_HEIGHT 0x806C
+#define GL_UNPACK_SKIP_IMAGES 0x806D
+#define GL_UNPACK_IMAGE_HEIGHT 0x806E
+#define GL_TEXTURE_3D 0x806F
+#define GL_PROXY_TEXTURE_3D 0x8070
+#define GL_TEXTURE_DEPTH 0x8071
+#define GL_TEXTURE_WRAP_R 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE 0x8073
+#define GL_BGR 0x80E0
+#define GL_BGRA 0x80E1
+#define GL_MAX_ELEMENTS_VERTICES 0x80E8
+#define GL_MAX_ELEMENTS_INDICES 0x80E9
+#define GL_CLAMP_TO_EDGE 0x812F
+#define GL_TEXTURE_MIN_LOD 0x813A
+#define GL_TEXTURE_MAX_LOD 0x813B
+#define GL_TEXTURE_BASE_LEVEL 0x813C
+#define GL_TEXTURE_MAX_LEVEL 0x813D
+#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8
+#define GL_SINGLE_COLOR 0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR 0x81FA
+#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362
+#define GL_UNSIGNED_SHORT_5_6_5 0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367
+#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368
+#define GL_ALIASED_POINT_SIZE_RANGE 0x846D
+#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E
+
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
+
+#define glCopyTexSubImage3D GLEW_GET_FUN(__glewCopyTexSubImage3D)
+#define glDrawRangeElements GLEW_GET_FUN(__glewDrawRangeElements)
+#define glTexImage3D GLEW_GET_FUN(__glewTexImage3D)
+#define glTexSubImage3D GLEW_GET_FUN(__glewTexSubImage3D)
+
+#define GLEW_VERSION_1_2 GLEW_GET_VAR(__GLEW_VERSION_1_2)
+
+#endif /* GL_VERSION_1_2 */
+
+/* ----------------------------- GL_VERSION_1_3 ---------------------------- */
+
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+
+#define GL_MULTISAMPLE 0x809D
+#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE 0x809F
+#define GL_SAMPLE_COVERAGE 0x80A0
+#define GL_SAMPLE_BUFFERS 0x80A8
+#define GL_SAMPLES 0x80A9
+#define GL_SAMPLE_COVERAGE_VALUE 0x80AA
+#define GL_SAMPLE_COVERAGE_INVERT 0x80AB
+#define GL_CLAMP_TO_BORDER 0x812D
+#define GL_TEXTURE0 0x84C0
+#define GL_TEXTURE1 0x84C1
+#define GL_TEXTURE2 0x84C2
+#define GL_TEXTURE3 0x84C3
+#define GL_TEXTURE4 0x84C4
+#define GL_TEXTURE5 0x84C5
+#define GL_TEXTURE6 0x84C6
+#define GL_TEXTURE7 0x84C7
+#define GL_TEXTURE8 0x84C8
+#define GL_TEXTURE9 0x84C9
+#define GL_TEXTURE10 0x84CA
+#define GL_TEXTURE11 0x84CB
+#define GL_TEXTURE12 0x84CC
+#define GL_TEXTURE13 0x84CD
+#define GL_TEXTURE14 0x84CE
+#define GL_TEXTURE15 0x84CF
+#define GL_TEXTURE16 0x84D0
+#define GL_TEXTURE17 0x84D1
+#define GL_TEXTURE18 0x84D2
+#define GL_TEXTURE19 0x84D3
+#define GL_TEXTURE20 0x84D4
+#define GL_TEXTURE21 0x84D5
+#define GL_TEXTURE22 0x84D6
+#define GL_TEXTURE23 0x84D7
+#define GL_TEXTURE24 0x84D8
+#define GL_TEXTURE25 0x84D9
+#define GL_TEXTURE26 0x84DA
+#define GL_TEXTURE27 0x84DB
+#define GL_TEXTURE28 0x84DC
+#define GL_TEXTURE29 0x84DD
+#define GL_TEXTURE30 0x84DE
+#define GL_TEXTURE31 0x84DF
+#define GL_ACTIVE_TEXTURE 0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1
+#define GL_MAX_TEXTURE_UNITS 0x84E2
+#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3
+#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4
+#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5
+#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6
+#define GL_SUBTRACT 0x84E7
+#define GL_COMPRESSED_ALPHA 0x84E9
+#define GL_COMPRESSED_LUMINANCE 0x84EA
+#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB
+#define GL_COMPRESSED_INTENSITY 0x84EC
+#define GL_COMPRESSED_RGB 0x84ED
+#define GL_COMPRESSED_RGBA 0x84EE
+#define GL_TEXTURE_COMPRESSION_HINT 0x84EF
+#define GL_NORMAL_MAP 0x8511
+#define GL_REFLECTION_MAP 0x8512
+#define GL_TEXTURE_CUBE_MAP 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C
+#define GL_COMBINE 0x8570
+#define GL_COMBINE_RGB 0x8571
+#define GL_COMBINE_ALPHA 0x8572
+#define GL_RGB_SCALE 0x8573
+#define GL_ADD_SIGNED 0x8574
+#define GL_INTERPOLATE 0x8575
+#define GL_CONSTANT 0x8576
+#define GL_PRIMARY_COLOR 0x8577
+#define GL_PREVIOUS 0x8578
+#define GL_SOURCE0_RGB 0x8580
+#define GL_SOURCE1_RGB 0x8581
+#define GL_SOURCE2_RGB 0x8582
+#define GL_SOURCE0_ALPHA 0x8588
+#define GL_SOURCE1_ALPHA 0x8589
+#define GL_SOURCE2_ALPHA 0x858A
+#define GL_OPERAND0_RGB 0x8590
+#define GL_OPERAND1_RGB 0x8591
+#define GL_OPERAND2_RGB 0x8592
+#define GL_OPERAND0_ALPHA 0x8598
+#define GL_OPERAND1_ALPHA 0x8599
+#define GL_OPERAND2_ALPHA 0x859A
+#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0
+#define GL_TEXTURE_COMPRESSED 0x86A1
+#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2
+#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3
+#define GL_DOT3_RGB 0x86AE
+#define GL_DOT3_RGBA 0x86AF
+#define GL_MULTISAMPLE_BIT 0x20000000
+
+typedef void (GLAPIENTRY * PFNGLACTIVETEXTUREPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint lod, GLvoid *img);
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
+
+#define glActiveTexture GLEW_GET_FUN(__glewActiveTexture)
+#define glClientActiveTexture GLEW_GET_FUN(__glewClientActiveTexture)
+#define glCompressedTexImage1D GLEW_GET_FUN(__glewCompressedTexImage1D)
+#define glCompressedTexImage2D GLEW_GET_FUN(__glewCompressedTexImage2D)
+#define glCompressedTexImage3D GLEW_GET_FUN(__glewCompressedTexImage3D)
+#define glCompressedTexSubImage1D GLEW_GET_FUN(__glewCompressedTexSubImage1D)
+#define glCompressedTexSubImage2D GLEW_GET_FUN(__glewCompressedTexSubImage2D)
+#define glCompressedTexSubImage3D GLEW_GET_FUN(__glewCompressedTexSubImage3D)
+#define glGetCompressedTexImage GLEW_GET_FUN(__glewGetCompressedTexImage)
+#define glLoadTransposeMatrixd GLEW_GET_FUN(__glewLoadTransposeMatrixd)
+#define glLoadTransposeMatrixf GLEW_GET_FUN(__glewLoadTransposeMatrixf)
+#define glMultTransposeMatrixd GLEW_GET_FUN(__glewMultTransposeMatrixd)
+#define glMultTransposeMatrixf GLEW_GET_FUN(__glewMultTransposeMatrixf)
+#define glMultiTexCoord1d GLEW_GET_FUN(__glewMultiTexCoord1d)
+#define glMultiTexCoord1dv GLEW_GET_FUN(__glewMultiTexCoord1dv)
+#define glMultiTexCoord1f GLEW_GET_FUN(__glewMultiTexCoord1f)
+#define glMultiTexCoord1fv GLEW_GET_FUN(__glewMultiTexCoord1fv)
+#define glMultiTexCoord1i GLEW_GET_FUN(__glewMultiTexCoord1i)
+#define glMultiTexCoord1iv GLEW_GET_FUN(__glewMultiTexCoord1iv)
+#define glMultiTexCoord1s GLEW_GET_FUN(__glewMultiTexCoord1s)
+#define glMultiTexCoord1sv GLEW_GET_FUN(__glewMultiTexCoord1sv)
+#define glMultiTexCoord2d GLEW_GET_FUN(__glewMultiTexCoord2d)
+#define glMultiTexCoord2dv GLEW_GET_FUN(__glewMultiTexCoord2dv)
+#define glMultiTexCoord2f GLEW_GET_FUN(__glewMultiTexCoord2f)
+#define glMultiTexCoord2fv GLEW_GET_FUN(__glewMultiTexCoord2fv)
+#define glMultiTexCoord2i GLEW_GET_FUN(__glewMultiTexCoord2i)
+#define glMultiTexCoord2iv GLEW_GET_FUN(__glewMultiTexCoord2iv)
+#define glMultiTexCoord2s GLEW_GET_FUN(__glewMultiTexCoord2s)
+#define glMultiTexCoord2sv GLEW_GET_FUN(__glewMultiTexCoord2sv)
+#define glMultiTexCoord3d GLEW_GET_FUN(__glewMultiTexCoord3d)
+#define glMultiTexCoord3dv GLEW_GET_FUN(__glewMultiTexCoord3dv)
+#define glMultiTexCoord3f GLEW_GET_FUN(__glewMultiTexCoord3f)
+#define glMultiTexCoord3fv GLEW_GET_FUN(__glewMultiTexCoord3fv)
+#define glMultiTexCoord3i GLEW_GET_FUN(__glewMultiTexCoord3i)
+#define glMultiTexCoord3iv GLEW_GET_FUN(__glewMultiTexCoord3iv)
+#define glMultiTexCoord3s GLEW_GET_FUN(__glewMultiTexCoord3s)
+#define glMultiTexCoord3sv GLEW_GET_FUN(__glewMultiTexCoord3sv)
+#define glMultiTexCoord4d GLEW_GET_FUN(__glewMultiTexCoord4d)
+#define glMultiTexCoord4dv GLEW_GET_FUN(__glewMultiTexCoord4dv)
+#define glMultiTexCoord4f GLEW_GET_FUN(__glewMultiTexCoord4f)
+#define glMultiTexCoord4fv GLEW_GET_FUN(__glewMultiTexCoord4fv)
+#define glMultiTexCoord4i GLEW_GET_FUN(__glewMultiTexCoord4i)
+#define glMultiTexCoord4iv GLEW_GET_FUN(__glewMultiTexCoord4iv)
+#define glMultiTexCoord4s GLEW_GET_FUN(__glewMultiTexCoord4s)
+#define glMultiTexCoord4sv GLEW_GET_FUN(__glewMultiTexCoord4sv)
+#define glSampleCoverage GLEW_GET_FUN(__glewSampleCoverage)
+
+#define GLEW_VERSION_1_3 GLEW_GET_VAR(__GLEW_VERSION_1_3)
+
+#endif /* GL_VERSION_1_3 */
+
+/* ----------------------------- GL_VERSION_1_4 ---------------------------- */
+
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+
+#define GL_BLEND_DST_RGB 0x80C8
+#define GL_BLEND_SRC_RGB 0x80C9
+#define GL_BLEND_DST_ALPHA 0x80CA
+#define GL_BLEND_SRC_ALPHA 0x80CB
+#define GL_POINT_SIZE_MIN 0x8126
+#define GL_POINT_SIZE_MAX 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128
+#define GL_POINT_DISTANCE_ATTENUATION 0x8129
+#define GL_GENERATE_MIPMAP 0x8191
+#define GL_GENERATE_MIPMAP_HINT 0x8192
+#define GL_DEPTH_COMPONENT16 0x81A5
+#define GL_DEPTH_COMPONENT24 0x81A6
+#define GL_DEPTH_COMPONENT32 0x81A7
+#define GL_MIRRORED_REPEAT 0x8370
+#define GL_FOG_COORDINATE_SOURCE 0x8450
+#define GL_FOG_COORDINATE 0x8451
+#define GL_FRAGMENT_DEPTH 0x8452
+#define GL_CURRENT_FOG_COORDINATE 0x8453
+#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454
+#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455
+#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456
+#define GL_FOG_COORDINATE_ARRAY 0x8457
+#define GL_COLOR_SUM 0x8458
+#define GL_CURRENT_SECONDARY_COLOR 0x8459
+#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A
+#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B
+#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C
+#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D
+#define GL_SECONDARY_COLOR_ARRAY 0x845E
+#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD
+#define GL_TEXTURE_FILTER_CONTROL 0x8500
+#define GL_TEXTURE_LOD_BIAS 0x8501
+#define GL_INCR_WRAP 0x8507
+#define GL_DECR_WRAP 0x8508
+#define GL_TEXTURE_DEPTH_SIZE 0x884A
+#define GL_DEPTH_TEXTURE_MODE 0x884B
+#define GL_TEXTURE_COMPARE_MODE 0x884C
+#define GL_TEXTURE_COMPARE_FUNC 0x884D
+#define GL_COMPARE_R_TO_TEXTURE 0x884E
+
+typedef void (GLAPIENTRY * PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONPROC) (GLenum mode);
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDPROC) (GLdouble coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFPROC) (GLfloat coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, GLsizei *count, GLenum type, const GLvoid **indices, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVPROC) (GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, GLvoid *pointer);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVPROC) (const GLshort *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVPROC) (const GLdouble *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVPROC) (const GLfloat *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVPROC) (const GLint *p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVPROC) (const GLshort *p);
+
+#define glBlendColor GLEW_GET_FUN(__glewBlendColor)
+#define glBlendEquation GLEW_GET_FUN(__glewBlendEquation)
+#define glBlendFuncSeparate GLEW_GET_FUN(__glewBlendFuncSeparate)
+#define glFogCoordPointer GLEW_GET_FUN(__glewFogCoordPointer)
+#define glFogCoordd GLEW_GET_FUN(__glewFogCoordd)
+#define glFogCoorddv GLEW_GET_FUN(__glewFogCoorddv)
+#define glFogCoordf GLEW_GET_FUN(__glewFogCoordf)
+#define glFogCoordfv GLEW_GET_FUN(__glewFogCoordfv)
+#define glMultiDrawArrays GLEW_GET_FUN(__glewMultiDrawArrays)
+#define glMultiDrawElements GLEW_GET_FUN(__glewMultiDrawElements)
+#define glPointParameterf GLEW_GET_FUN(__glewPointParameterf)
+#define glPointParameterfv GLEW_GET_FUN(__glewPointParameterfv)
+#define glSecondaryColor3b GLEW_GET_FUN(__glewSecondaryColor3b)
+#define glSecondaryColor3bv GLEW_GET_FUN(__glewSecondaryColor3bv)
+#define glSecondaryColor3d GLEW_GET_FUN(__glewSecondaryColor3d)
+#define glSecondaryColor3dv GLEW_GET_FUN(__glewSecondaryColor3dv)
+#define glSecondaryColor3f GLEW_GET_FUN(__glewSecondaryColor3f)
+#define glSecondaryColor3fv GLEW_GET_FUN(__glewSecondaryColor3fv)
+#define glSecondaryColor3i GLEW_GET_FUN(__glewSecondaryColor3i)
+#define glSecondaryColor3iv GLEW_GET_FUN(__glewSecondaryColor3iv)
+#define glSecondaryColor3s GLEW_GET_FUN(__glewSecondaryColor3s)
+#define glSecondaryColor3sv GLEW_GET_FUN(__glewSecondaryColor3sv)
+#define glSecondaryColor3ub GLEW_GET_FUN(__glewSecondaryColor3ub)
+#define glSecondaryColor3ubv GLEW_GET_FUN(__glewSecondaryColor3ubv)
+#define glSecondaryColor3ui GLEW_GET_FUN(__glewSecondaryColor3ui)
+#define glSecondaryColor3uiv GLEW_GET_FUN(__glewSecondaryColor3uiv)
+#define glSecondaryColor3us GLEW_GET_FUN(__glewSecondaryColor3us)
+#define glSecondaryColor3usv GLEW_GET_FUN(__glewSecondaryColor3usv)
+#define glSecondaryColorPointer GLEW_GET_FUN(__glewSecondaryColorPointer)
+#define glWindowPos2d GLEW_GET_FUN(__glewWindowPos2d)
+#define glWindowPos2dv GLEW_GET_FUN(__glewWindowPos2dv)
+#define glWindowPos2f GLEW_GET_FUN(__glewWindowPos2f)
+#define glWindowPos2fv GLEW_GET_FUN(__glewWindowPos2fv)
+#define glWindowPos2i GLEW_GET_FUN(__glewWindowPos2i)
+#define glWindowPos2iv GLEW_GET_FUN(__glewWindowPos2iv)
+#define glWindowPos2s GLEW_GET_FUN(__glewWindowPos2s)
+#define glWindowPos2sv GLEW_GET_FUN(__glewWindowPos2sv)
+#define glWindowPos3d GLEW_GET_FUN(__glewWindowPos3d)
+#define glWindowPos3dv GLEW_GET_FUN(__glewWindowPos3dv)
+#define glWindowPos3f GLEW_GET_FUN(__glewWindowPos3f)
+#define glWindowPos3fv GLEW_GET_FUN(__glewWindowPos3fv)
+#define glWindowPos3i GLEW_GET_FUN(__glewWindowPos3i)
+#define glWindowPos3iv GLEW_GET_FUN(__glewWindowPos3iv)
+#define glWindowPos3s GLEW_GET_FUN(__glewWindowPos3s)
+#define glWindowPos3sv GLEW_GET_FUN(__glewWindowPos3sv)
+
+#define GLEW_VERSION_1_4 GLEW_GET_VAR(__GLEW_VERSION_1_4)
+
+#endif /* GL_VERSION_1_4 */
+
+/* ----------------------------- GL_VERSION_1_5 ---------------------------- */
+
+#ifndef GL_VERSION_1_5
+#define GL_VERSION_1_5 1
+
+#define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE
+#define GL_FOG_COORD GL_FOG_COORDINATE
+#define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY
+#define GL_SRC0_RGB GL_SOURCE0_RGB
+#define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER
+#define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE
+#define GL_SRC1_ALPHA GL_SOURCE1_ALPHA
+#define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE
+#define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE
+#define GL_SRC0_ALPHA GL_SOURCE0_ALPHA
+#define GL_SRC1_RGB GL_SOURCE1_RGB
+#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING
+#define GL_SRC2_ALPHA GL_SOURCE2_ALPHA
+#define GL_SRC2_RGB GL_SOURCE2_RGB
+#define GL_BUFFER_SIZE 0x8764
+#define GL_BUFFER_USAGE 0x8765
+#define GL_QUERY_COUNTER_BITS 0x8864
+#define GL_CURRENT_QUERY 0x8865
+#define GL_QUERY_RESULT 0x8866
+#define GL_QUERY_RESULT_AVAILABLE 0x8867
+#define GL_ARRAY_BUFFER 0x8892
+#define GL_ELEMENT_ARRAY_BUFFER 0x8893
+#define GL_ARRAY_BUFFER_BINDING 0x8894
+#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895
+#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896
+#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897
+#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898
+#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899
+#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A
+#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B
+#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C
+#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D
+#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E
+#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F
+#define GL_READ_ONLY 0x88B8
+#define GL_WRITE_ONLY 0x88B9
+#define GL_READ_WRITE 0x88BA
+#define GL_BUFFER_ACCESS 0x88BB
+#define GL_BUFFER_MAPPED 0x88BC
+#define GL_BUFFER_MAP_POINTER 0x88BD
+#define GL_STREAM_DRAW 0x88E0
+#define GL_STREAM_READ 0x88E1
+#define GL_STREAM_COPY 0x88E2
+#define GL_STATIC_DRAW 0x88E4
+#define GL_STATIC_READ 0x88E5
+#define GL_STATIC_COPY 0x88E6
+#define GL_DYNAMIC_DRAW 0x88E8
+#define GL_DYNAMIC_READ 0x88E9
+#define GL_DYNAMIC_COPY 0x88EA
+#define GL_SAMPLES_PASSED 0x8914
+
+typedef ptrdiff_t GLsizeiptr;
+typedef ptrdiff_t GLintptr;
+
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid* data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid* data);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENBUFFERSPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid** params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid* data);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERPROC) (GLuint buffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYPROC) (GLuint id);
+typedef GLvoid* (GLAPIENTRY * PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
+typedef GLboolean (GLAPIENTRY * PFNGLUNMAPBUFFERPROC) (GLenum target);
+
+#define glBeginQuery GLEW_GET_FUN(__glewBeginQuery)
+#define glBindBuffer GLEW_GET_FUN(__glewBindBuffer)
+#define glBufferData GLEW_GET_FUN(__glewBufferData)
+#define glBufferSubData GLEW_GET_FUN(__glewBufferSubData)
+#define glDeleteBuffers GLEW_GET_FUN(__glewDeleteBuffers)
+#define glDeleteQueries GLEW_GET_FUN(__glewDeleteQueries)
+#define glEndQuery GLEW_GET_FUN(__glewEndQuery)
+#define glGenBuffers GLEW_GET_FUN(__glewGenBuffers)
+#define glGenQueries GLEW_GET_FUN(__glewGenQueries)
+#define glGetBufferParameteriv GLEW_GET_FUN(__glewGetBufferParameteriv)
+#define glGetBufferPointerv GLEW_GET_FUN(__glewGetBufferPointerv)
+#define glGetBufferSubData GLEW_GET_FUN(__glewGetBufferSubData)
+#define glGetQueryObjectiv GLEW_GET_FUN(__glewGetQueryObjectiv)
+#define glGetQueryObjectuiv GLEW_GET_FUN(__glewGetQueryObjectuiv)
+#define glGetQueryiv GLEW_GET_FUN(__glewGetQueryiv)
+#define glIsBuffer GLEW_GET_FUN(__glewIsBuffer)
+#define glIsQuery GLEW_GET_FUN(__glewIsQuery)
+#define glMapBuffer GLEW_GET_FUN(__glewMapBuffer)
+#define glUnmapBuffer GLEW_GET_FUN(__glewUnmapBuffer)
+
+#define GLEW_VERSION_1_5 GLEW_GET_VAR(__GLEW_VERSION_1_5)
+
+#endif /* GL_VERSION_1_5 */
+
+/* ----------------------------- GL_VERSION_2_0 ---------------------------- */
+
+#ifndef GL_VERSION_2_0
+#define GL_VERSION_2_0 1
+
+#define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION
+#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622
+#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623
+#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624
+#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625
+#define GL_CURRENT_VERTEX_ATTRIB 0x8626
+#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643
+#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645
+#define GL_STENCIL_BACK_FUNC 0x8800
+#define GL_STENCIL_BACK_FAIL 0x8801
+#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802
+#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803
+#define GL_MAX_DRAW_BUFFERS 0x8824
+#define GL_DRAW_BUFFER0 0x8825
+#define GL_DRAW_BUFFER1 0x8826
+#define GL_DRAW_BUFFER2 0x8827
+#define GL_DRAW_BUFFER3 0x8828
+#define GL_DRAW_BUFFER4 0x8829
+#define GL_DRAW_BUFFER5 0x882A
+#define GL_DRAW_BUFFER6 0x882B
+#define GL_DRAW_BUFFER7 0x882C
+#define GL_DRAW_BUFFER8 0x882D
+#define GL_DRAW_BUFFER9 0x882E
+#define GL_DRAW_BUFFER10 0x882F
+#define GL_DRAW_BUFFER11 0x8830
+#define GL_DRAW_BUFFER12 0x8831
+#define GL_DRAW_BUFFER13 0x8832
+#define GL_DRAW_BUFFER14 0x8833
+#define GL_DRAW_BUFFER15 0x8834
+#define GL_BLEND_EQUATION_ALPHA 0x883D
+#define GL_POINT_SPRITE 0x8861
+#define GL_COORD_REPLACE 0x8862
+#define GL_MAX_VERTEX_ATTRIBS 0x8869
+#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A
+#define GL_MAX_TEXTURE_COORDS 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872
+#define GL_FRAGMENT_SHADER 0x8B30
+#define GL_VERTEX_SHADER 0x8B31
+#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49
+#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A
+#define GL_MAX_VARYING_FLOATS 0x8B4B
+#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C
+#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D
+#define GL_SHADER_TYPE 0x8B4F
+#define GL_FLOAT_VEC2 0x8B50
+#define GL_FLOAT_VEC3 0x8B51
+#define GL_FLOAT_VEC4 0x8B52
+#define GL_INT_VEC2 0x8B53
+#define GL_INT_VEC3 0x8B54
+#define GL_INT_VEC4 0x8B55
+#define GL_BOOL 0x8B56
+#define GL_BOOL_VEC2 0x8B57
+#define GL_BOOL_VEC3 0x8B58
+#define GL_BOOL_VEC4 0x8B59
+#define GL_FLOAT_MAT2 0x8B5A
+#define GL_FLOAT_MAT3 0x8B5B
+#define GL_FLOAT_MAT4 0x8B5C
+#define GL_SAMPLER_1D 0x8B5D
+#define GL_SAMPLER_2D 0x8B5E
+#define GL_SAMPLER_3D 0x8B5F
+#define GL_SAMPLER_CUBE 0x8B60
+#define GL_SAMPLER_1D_SHADOW 0x8B61
+#define GL_SAMPLER_2D_SHADOW 0x8B62
+#define GL_DELETE_STATUS 0x8B80
+#define GL_COMPILE_STATUS 0x8B81
+#define GL_LINK_STATUS 0x8B82
+#define GL_VALIDATE_STATUS 0x8B83
+#define GL_INFO_LOG_LENGTH 0x8B84
+#define GL_ATTACHED_SHADERS 0x8B85
+#define GL_ACTIVE_UNIFORMS 0x8B86
+#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87
+#define GL_SHADER_SOURCE_LENGTH 0x8B88
+#define GL_ACTIVE_ATTRIBUTES 0x8B89
+#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A
+#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B
+#define GL_SHADING_LANGUAGE_VERSION 0x8B8C
+#define GL_CURRENT_PROGRAM 0x8B8D
+#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0
+#define GL_LOWER_LEFT 0x8CA1
+#define GL_UPPER_LEFT 0x8CA2
+#define GL_STENCIL_BACK_REF 0x8CA3
+#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4
+#define GL_STENCIL_BACK_WRITEMASK 0x8CA5
+
+typedef char GLchar;
+
+typedef void (GLAPIENTRY * PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum, GLenum);
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERPROC) (GLuint shader);
+typedef GLuint (GLAPIENTRY * PFNGLCREATEPROGRAMPROC) (void);
+typedef GLuint (GLAPIENTRY * PFNGLCREATESHADERPROC) (GLenum type);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLDELETESHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
+typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint);
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum* bufs);
+typedef void (GLAPIENTRY * PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei maxLength, GLsizei* length, GLint* size, GLenum* type, GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei* count, GLuint* shaders);
+typedef GLint (GLAPIENTRY * PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint* param);
+typedef void (GLAPIENTRY * PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei* length, GLchar* infoLog);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEPROC) (GLint obj, GLsizei maxLength, GLsizei* length, GLchar* source);
+typedef void (GLAPIENTRY * PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint* param);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONPROC) (GLint programObj, const GLchar* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint, GLenum, GLvoid*);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVPROC) (GLuint, GLenum, GLdouble*);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVPROC) (GLuint, GLenum, GLfloat*);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVPROC) (GLuint, GLenum, GLint*);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMPROC) (GLuint program);
+typedef GLboolean (GLAPIENTRY * PFNGLISSHADERPROC) (GLuint shader);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar** strings, const GLint* lengths);
+typedef void (GLAPIENTRY * PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILMASKSEPARATEPROC) (GLenum, GLuint);
+typedef void (GLAPIENTRY * PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLVALIDATEPROGRAMPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid* pointer);
+
+#define glAttachShader GLEW_GET_FUN(__glewAttachShader)
+#define glBindAttribLocation GLEW_GET_FUN(__glewBindAttribLocation)
+#define glBlendEquationSeparate GLEW_GET_FUN(__glewBlendEquationSeparate)
+#define glCompileShader GLEW_GET_FUN(__glewCompileShader)
+#define glCreateProgram GLEW_GET_FUN(__glewCreateProgram)
+#define glCreateShader GLEW_GET_FUN(__glewCreateShader)
+#define glDeleteProgram GLEW_GET_FUN(__glewDeleteProgram)
+#define glDeleteShader GLEW_GET_FUN(__glewDeleteShader)
+#define glDetachShader GLEW_GET_FUN(__glewDetachShader)
+#define glDisableVertexAttribArray GLEW_GET_FUN(__glewDisableVertexAttribArray)
+#define glDrawBuffers GLEW_GET_FUN(__glewDrawBuffers)
+#define glEnableVertexAttribArray GLEW_GET_FUN(__glewEnableVertexAttribArray)
+#define glGetActiveAttrib GLEW_GET_FUN(__glewGetActiveAttrib)
+#define glGetActiveUniform GLEW_GET_FUN(__glewGetActiveUniform)
+#define glGetAttachedShaders GLEW_GET_FUN(__glewGetAttachedShaders)
+#define glGetAttribLocation GLEW_GET_FUN(__glewGetAttribLocation)
+#define glGetProgramInfoLog GLEW_GET_FUN(__glewGetProgramInfoLog)
+#define glGetProgramiv GLEW_GET_FUN(__glewGetProgramiv)
+#define glGetShaderInfoLog GLEW_GET_FUN(__glewGetShaderInfoLog)
+#define glGetShaderSource GLEW_GET_FUN(__glewGetShaderSource)
+#define glGetShaderiv GLEW_GET_FUN(__glewGetShaderiv)
+#define glGetUniformLocation GLEW_GET_FUN(__glewGetUniformLocation)
+#define glGetUniformfv GLEW_GET_FUN(__glewGetUniformfv)
+#define glGetUniformiv GLEW_GET_FUN(__glewGetUniformiv)
+#define glGetVertexAttribPointerv GLEW_GET_FUN(__glewGetVertexAttribPointerv)
+#define glGetVertexAttribdv GLEW_GET_FUN(__glewGetVertexAttribdv)
+#define glGetVertexAttribfv GLEW_GET_FUN(__glewGetVertexAttribfv)
+#define glGetVertexAttribiv GLEW_GET_FUN(__glewGetVertexAttribiv)
+#define glIsProgram GLEW_GET_FUN(__glewIsProgram)
+#define glIsShader GLEW_GET_FUN(__glewIsShader)
+#define glLinkProgram GLEW_GET_FUN(__glewLinkProgram)
+#define glShaderSource GLEW_GET_FUN(__glewShaderSource)
+#define glStencilFuncSeparate GLEW_GET_FUN(__glewStencilFuncSeparate)
+#define glStencilMaskSeparate GLEW_GET_FUN(__glewStencilMaskSeparate)
+#define glStencilOpSeparate GLEW_GET_FUN(__glewStencilOpSeparate)
+#define glUniform1f GLEW_GET_FUN(__glewUniform1f)
+#define glUniform1fv GLEW_GET_FUN(__glewUniform1fv)
+#define glUniform1i GLEW_GET_FUN(__glewUniform1i)
+#define glUniform1iv GLEW_GET_FUN(__glewUniform1iv)
+#define glUniform2f GLEW_GET_FUN(__glewUniform2f)
+#define glUniform2fv GLEW_GET_FUN(__glewUniform2fv)
+#define glUniform2i GLEW_GET_FUN(__glewUniform2i)
+#define glUniform2iv GLEW_GET_FUN(__glewUniform2iv)
+#define glUniform3f GLEW_GET_FUN(__glewUniform3f)
+#define glUniform3fv GLEW_GET_FUN(__glewUniform3fv)
+#define glUniform3i GLEW_GET_FUN(__glewUniform3i)
+#define glUniform3iv GLEW_GET_FUN(__glewUniform3iv)
+#define glUniform4f GLEW_GET_FUN(__glewUniform4f)
+#define glUniform4fv GLEW_GET_FUN(__glewUniform4fv)
+#define glUniform4i GLEW_GET_FUN(__glewUniform4i)
+#define glUniform4iv GLEW_GET_FUN(__glewUniform4iv)
+#define glUniformMatrix2fv GLEW_GET_FUN(__glewUniformMatrix2fv)
+#define glUniformMatrix3fv GLEW_GET_FUN(__glewUniformMatrix3fv)
+#define glUniformMatrix4fv GLEW_GET_FUN(__glewUniformMatrix4fv)
+#define glUseProgram GLEW_GET_FUN(__glewUseProgram)
+#define glValidateProgram GLEW_GET_FUN(__glewValidateProgram)
+#define glVertexAttrib1d GLEW_GET_FUN(__glewVertexAttrib1d)
+#define glVertexAttrib1dv GLEW_GET_FUN(__glewVertexAttrib1dv)
+#define glVertexAttrib1f GLEW_GET_FUN(__glewVertexAttrib1f)
+#define glVertexAttrib1fv GLEW_GET_FUN(__glewVertexAttrib1fv)
+#define glVertexAttrib1s GLEW_GET_FUN(__glewVertexAttrib1s)
+#define glVertexAttrib1sv GLEW_GET_FUN(__glewVertexAttrib1sv)
+#define glVertexAttrib2d GLEW_GET_FUN(__glewVertexAttrib2d)
+#define glVertexAttrib2dv GLEW_GET_FUN(__glewVertexAttrib2dv)
+#define glVertexAttrib2f GLEW_GET_FUN(__glewVertexAttrib2f)
+#define glVertexAttrib2fv GLEW_GET_FUN(__glewVertexAttrib2fv)
+#define glVertexAttrib2s GLEW_GET_FUN(__glewVertexAttrib2s)
+#define glVertexAttrib2sv GLEW_GET_FUN(__glewVertexAttrib2sv)
+#define glVertexAttrib3d GLEW_GET_FUN(__glewVertexAttrib3d)
+#define glVertexAttrib3dv GLEW_GET_FUN(__glewVertexAttrib3dv)
+#define glVertexAttrib3f GLEW_GET_FUN(__glewVertexAttrib3f)
+#define glVertexAttrib3fv GLEW_GET_FUN(__glewVertexAttrib3fv)
+#define glVertexAttrib3s GLEW_GET_FUN(__glewVertexAttrib3s)
+#define glVertexAttrib3sv GLEW_GET_FUN(__glewVertexAttrib3sv)
+#define glVertexAttrib4Nbv GLEW_GET_FUN(__glewVertexAttrib4Nbv)
+#define glVertexAttrib4Niv GLEW_GET_FUN(__glewVertexAttrib4Niv)
+#define glVertexAttrib4Nsv GLEW_GET_FUN(__glewVertexAttrib4Nsv)
+#define glVertexAttrib4Nub GLEW_GET_FUN(__glewVertexAttrib4Nub)
+#define glVertexAttrib4Nubv GLEW_GET_FUN(__glewVertexAttrib4Nubv)
+#define glVertexAttrib4Nuiv GLEW_GET_FUN(__glewVertexAttrib4Nuiv)
+#define glVertexAttrib4Nusv GLEW_GET_FUN(__glewVertexAttrib4Nusv)
+#define glVertexAttrib4bv GLEW_GET_FUN(__glewVertexAttrib4bv)
+#define glVertexAttrib4d GLEW_GET_FUN(__glewVertexAttrib4d)
+#define glVertexAttrib4dv GLEW_GET_FUN(__glewVertexAttrib4dv)
+#define glVertexAttrib4f GLEW_GET_FUN(__glewVertexAttrib4f)
+#define glVertexAttrib4fv GLEW_GET_FUN(__glewVertexAttrib4fv)
+#define glVertexAttrib4iv GLEW_GET_FUN(__glewVertexAttrib4iv)
+#define glVertexAttrib4s GLEW_GET_FUN(__glewVertexAttrib4s)
+#define glVertexAttrib4sv GLEW_GET_FUN(__glewVertexAttrib4sv)
+#define glVertexAttrib4ubv GLEW_GET_FUN(__glewVertexAttrib4ubv)
+#define glVertexAttrib4uiv GLEW_GET_FUN(__glewVertexAttrib4uiv)
+#define glVertexAttrib4usv GLEW_GET_FUN(__glewVertexAttrib4usv)
+#define glVertexAttribPointer GLEW_GET_FUN(__glewVertexAttribPointer)
+
+#define GLEW_VERSION_2_0 GLEW_GET_VAR(__GLEW_VERSION_2_0)
+
+#endif /* GL_VERSION_2_0 */
+
+/* -------------------------- GL_3DFX_multisample -------------------------- */
+
+#ifndef GL_3DFX_multisample
+#define GL_3DFX_multisample 1
+
+#define GL_MULTISAMPLE_3DFX 0x86B2
+#define GL_SAMPLE_BUFFERS_3DFX 0x86B3
+#define GL_SAMPLES_3DFX 0x86B4
+#define GL_MULTISAMPLE_BIT_3DFX 0x20000000
+
+#define GLEW_3DFX_multisample GLEW_GET_VAR(__GLEW_3DFX_multisample)
+
+#endif /* GL_3DFX_multisample */
+
+/* ---------------------------- GL_3DFX_tbuffer ---------------------------- */
+
+#ifndef GL_3DFX_tbuffer
+#define GL_3DFX_tbuffer 1
+
+typedef void (GLAPIENTRY * PFNGLTBUFFERMASK3DFXPROC) (GLuint mask);
+
+#define glTbufferMask3DFX GLEW_GET_FUN(__glewTbufferMask3DFX)
+
+#define GLEW_3DFX_tbuffer GLEW_GET_VAR(__GLEW_3DFX_tbuffer)
+
+#endif /* GL_3DFX_tbuffer */
+
+/* -------------------- GL_3DFX_texture_compression_FXT1 ------------------- */
+
+#ifndef GL_3DFX_texture_compression_FXT1
+#define GL_3DFX_texture_compression_FXT1 1
+
+#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0
+#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1
+
+#define GLEW_3DFX_texture_compression_FXT1 GLEW_GET_VAR(__GLEW_3DFX_texture_compression_FXT1)
+
+#endif /* GL_3DFX_texture_compression_FXT1 */
+
+/* ------------------------ GL_APPLE_client_storage ------------------------ */
+
+#ifndef GL_APPLE_client_storage
+#define GL_APPLE_client_storage 1
+
+#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2
+
+#define GLEW_APPLE_client_storage GLEW_GET_VAR(__GLEW_APPLE_client_storage)
+
+#endif /* GL_APPLE_client_storage */
+
+/* ------------------------- GL_APPLE_element_array ------------------------ */
+
+#ifndef GL_APPLE_element_array
+#define GL_APPLE_element_array 1
+
+#define GL_ELEMENT_ARRAY_APPLE 0x8768
+#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769
+#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A
+
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint* first, const GLsizei *count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint* first, const GLsizei *count, GLsizei primcount);
+
+#define glDrawElementArrayAPPLE GLEW_GET_FUN(__glewDrawElementArrayAPPLE)
+#define glDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewDrawRangeElementArrayAPPLE)
+#define glElementPointerAPPLE GLEW_GET_FUN(__glewElementPointerAPPLE)
+#define glMultiDrawElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawElementArrayAPPLE)
+#define glMultiDrawRangeElementArrayAPPLE GLEW_GET_FUN(__glewMultiDrawRangeElementArrayAPPLE)
+
+#define GLEW_APPLE_element_array GLEW_GET_VAR(__GLEW_APPLE_element_array)
+
+#endif /* GL_APPLE_element_array */
+
+/* ----------------------------- GL_APPLE_fence ---------------------------- */
+
+#ifndef GL_APPLE_fence
+#define GL_APPLE_fence 1
+
+#define GL_DRAW_PIXELS_APPLE 0x8A0A
+#define GL_FENCE_APPLE 0x8A0B
+
+typedef void (GLAPIENTRY * PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint* fences);
+typedef void (GLAPIENTRY * PFNGLFINISHFENCEAPPLEPROC) (GLuint fence);
+typedef void (GLAPIENTRY * PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
+typedef void (GLAPIENTRY * PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint* fences);
+typedef GLboolean (GLAPIENTRY * PFNGLISFENCEAPPLEPROC) (GLuint fence);
+typedef void (GLAPIENTRY * PFNGLSETFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (GLAPIENTRY * PFNGLTESTFENCEAPPLEPROC) (GLuint fence);
+typedef GLboolean (GLAPIENTRY * PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
+
+#define glDeleteFencesAPPLE GLEW_GET_FUN(__glewDeleteFencesAPPLE)
+#define glFinishFenceAPPLE GLEW_GET_FUN(__glewFinishFenceAPPLE)
+#define glFinishObjectAPPLE GLEW_GET_FUN(__glewFinishObjectAPPLE)
+#define glGenFencesAPPLE GLEW_GET_FUN(__glewGenFencesAPPLE)
+#define glIsFenceAPPLE GLEW_GET_FUN(__glewIsFenceAPPLE)
+#define glSetFenceAPPLE GLEW_GET_FUN(__glewSetFenceAPPLE)
+#define glTestFenceAPPLE GLEW_GET_FUN(__glewTestFenceAPPLE)
+#define glTestObjectAPPLE GLEW_GET_FUN(__glewTestObjectAPPLE)
+
+#define GLEW_APPLE_fence GLEW_GET_VAR(__GLEW_APPLE_fence)
+
+#endif /* GL_APPLE_fence */
+
+/* ------------------------- GL_APPLE_float_pixels ------------------------- */
+
+#ifndef GL_APPLE_float_pixels
+#define GL_APPLE_float_pixels 1
+
+#define GL_HALF_APPLE 0x140B
+#define GL_RGBA_FLOAT32_APPLE 0x8814
+#define GL_RGB_FLOAT32_APPLE 0x8815
+#define GL_ALPHA_FLOAT32_APPLE 0x8816
+#define GL_INTENSITY_FLOAT32_APPLE 0x8817
+#define GL_LUMINANCE_FLOAT32_APPLE 0x8818
+#define GL_LUMINANCE_ALPHA_FLOAT32_APPLE 0x8819
+#define GL_RGBA_FLOAT16_APPLE 0x881A
+#define GL_RGB_FLOAT16_APPLE 0x881B
+#define GL_ALPHA_FLOAT16_APPLE 0x881C
+#define GL_INTENSITY_FLOAT16_APPLE 0x881D
+#define GL_LUMINANCE_FLOAT16_APPLE 0x881E
+#define GL_LUMINANCE_ALPHA_FLOAT16_APPLE 0x881F
+#define GL_COLOR_FLOAT_APPLE 0x8A0F
+
+#define GLEW_APPLE_float_pixels GLEW_GET_VAR(__GLEW_APPLE_float_pixels)
+
+#endif /* GL_APPLE_float_pixels */
+
+/* ------------------------- GL_APPLE_pixel_buffer ------------------------- */
+
+#ifndef GL_APPLE_pixel_buffer
+#define GL_APPLE_pixel_buffer 1
+
+#define GL_MIN_PBUFFER_VIEWPORT_DIMS_APPLE 0x8A10
+
+#define GLEW_APPLE_pixel_buffer GLEW_GET_VAR(__GLEW_APPLE_pixel_buffer)
+
+#endif /* GL_APPLE_pixel_buffer */
+
+/* ------------------------ GL_APPLE_specular_vector ----------------------- */
+
+#ifndef GL_APPLE_specular_vector
+#define GL_APPLE_specular_vector 1
+
+#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0
+
+#define GLEW_APPLE_specular_vector GLEW_GET_VAR(__GLEW_APPLE_specular_vector)
+
+#endif /* GL_APPLE_specular_vector */
+
+/* ------------------------- GL_APPLE_texture_range ------------------------ */
+
+#ifndef GL_APPLE_texture_range
+#define GL_APPLE_texture_range 1
+
+#define GL_TEXTURE_RANGE_LENGTH_APPLE 0x85B7
+#define GL_TEXTURE_RANGE_POINTER_APPLE 0x85B8
+#define GL_TEXTURE_STORAGE_HINT_APPLE 0x85BC
+#define GL_STORAGE_PRIVATE_APPLE 0x85BD
+#define GL_STORAGE_CACHED_APPLE 0x85BE
+#define GL_STORAGE_SHARED_APPLE 0x85BF
+
+typedef void (GLAPIENTRY * PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, GLvoid **params);
+typedef void (GLAPIENTRY * PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, GLvoid *pointer);
+
+#define glGetTexParameterPointervAPPLE GLEW_GET_FUN(__glewGetTexParameterPointervAPPLE)
+#define glTextureRangeAPPLE GLEW_GET_FUN(__glewTextureRangeAPPLE)
+
+#define GLEW_APPLE_texture_range GLEW_GET_VAR(__GLEW_APPLE_texture_range)
+
+#endif /* GL_APPLE_texture_range */
+
+/* ------------------------ GL_APPLE_transform_hint ------------------------ */
+
+#ifndef GL_APPLE_transform_hint
+#define GL_APPLE_transform_hint 1
+
+#define GL_TRANSFORM_HINT_APPLE 0x85B1
+
+#define GLEW_APPLE_transform_hint GLEW_GET_VAR(__GLEW_APPLE_transform_hint)
+
+#endif /* GL_APPLE_transform_hint */
+
+/* ---------------------- GL_APPLE_vertex_array_object --------------------- */
+
+#ifndef GL_APPLE_vertex_array_object
+#define GL_APPLE_vertex_array_object 1
+
+#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5
+
+typedef void (GLAPIENTRY * PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array);
+typedef void (GLAPIENTRY * PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+typedef void (GLAPIENTRY * PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint* arrays);
+typedef GLboolean (GLAPIENTRY * PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array);
+
+#define glBindVertexArrayAPPLE GLEW_GET_FUN(__glewBindVertexArrayAPPLE)
+#define glDeleteVertexArraysAPPLE GLEW_GET_FUN(__glewDeleteVertexArraysAPPLE)
+#define glGenVertexArraysAPPLE GLEW_GET_FUN(__glewGenVertexArraysAPPLE)
+#define glIsVertexArrayAPPLE GLEW_GET_FUN(__glewIsVertexArrayAPPLE)
+
+#define GLEW_APPLE_vertex_array_object GLEW_GET_VAR(__GLEW_APPLE_vertex_array_object)
+
+#endif /* GL_APPLE_vertex_array_object */
+
+/* ---------------------- GL_APPLE_vertex_array_range ---------------------- */
+
+#ifndef GL_APPLE_vertex_array_range
+#define GL_APPLE_vertex_array_range 1
+
+#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D
+#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E
+#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F
+#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_APPLE 0x8520
+#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521
+#define GL_STORAGE_CACHED_APPLE 0x85BE
+#define GL_STORAGE_SHARED_APPLE 0x85BF
+
+typedef void (GLAPIENTRY * PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void* pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, void* pointer);
+
+#define glFlushVertexArrayRangeAPPLE GLEW_GET_FUN(__glewFlushVertexArrayRangeAPPLE)
+#define glVertexArrayParameteriAPPLE GLEW_GET_FUN(__glewVertexArrayParameteriAPPLE)
+#define glVertexArrayRangeAPPLE GLEW_GET_FUN(__glewVertexArrayRangeAPPLE)
+
+#define GLEW_APPLE_vertex_array_range GLEW_GET_VAR(__GLEW_APPLE_vertex_array_range)
+
+#endif /* GL_APPLE_vertex_array_range */
+
+/* --------------------------- GL_APPLE_ycbcr_422 -------------------------- */
+
+#ifndef GL_APPLE_ycbcr_422
+#define GL_APPLE_ycbcr_422 1
+
+#define GL_YCBCR_422_APPLE 0x85B9
+#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA
+#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB
+
+#define GLEW_APPLE_ycbcr_422 GLEW_GET_VAR(__GLEW_APPLE_ycbcr_422)
+
+#endif /* GL_APPLE_ycbcr_422 */
+
+/* ----------------------- GL_ARB_color_buffer_float ----------------------- */
+
+#ifndef GL_ARB_color_buffer_float
+#define GL_ARB_color_buffer_float 1
+
+#define GL_RGBA_FLOAT_MODE_ARB 0x8820
+#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A
+#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B
+#define GL_CLAMP_READ_COLOR_ARB 0x891C
+#define GL_FIXED_ONLY_ARB 0x891D
+
+typedef void (GLAPIENTRY * PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
+
+#define glClampColorARB GLEW_GET_FUN(__glewClampColorARB)
+
+#define GLEW_ARB_color_buffer_float GLEW_GET_VAR(__GLEW_ARB_color_buffer_float)
+
+#endif /* GL_ARB_color_buffer_float */
+
+/* -------------------------- GL_ARB_depth_texture ------------------------- */
+
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+
+#define GL_DEPTH_COMPONENT16_ARB 0x81A5
+#define GL_DEPTH_COMPONENT24_ARB 0x81A6
+#define GL_DEPTH_COMPONENT32_ARB 0x81A7
+#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A
+#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B
+
+#define GLEW_ARB_depth_texture GLEW_GET_VAR(__GLEW_ARB_depth_texture)
+
+#endif /* GL_ARB_depth_texture */
+
+/* -------------------------- GL_ARB_draw_buffers -------------------------- */
+
+#ifndef GL_ARB_draw_buffers
+#define GL_ARB_draw_buffers 1
+
+#define GL_MAX_DRAW_BUFFERS_ARB 0x8824
+#define GL_DRAW_BUFFER0_ARB 0x8825
+#define GL_DRAW_BUFFER1_ARB 0x8826
+#define GL_DRAW_BUFFER2_ARB 0x8827
+#define GL_DRAW_BUFFER3_ARB 0x8828
+#define GL_DRAW_BUFFER4_ARB 0x8829
+#define GL_DRAW_BUFFER5_ARB 0x882A
+#define GL_DRAW_BUFFER6_ARB 0x882B
+#define GL_DRAW_BUFFER7_ARB 0x882C
+#define GL_DRAW_BUFFER8_ARB 0x882D
+#define GL_DRAW_BUFFER9_ARB 0x882E
+#define GL_DRAW_BUFFER10_ARB 0x882F
+#define GL_DRAW_BUFFER11_ARB 0x8830
+#define GL_DRAW_BUFFER12_ARB 0x8831
+#define GL_DRAW_BUFFER13_ARB 0x8832
+#define GL_DRAW_BUFFER14_ARB 0x8833
+#define GL_DRAW_BUFFER15_ARB 0x8834
+
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum* bufs);
+
+#define glDrawBuffersARB GLEW_GET_FUN(__glewDrawBuffersARB)
+
+#define GLEW_ARB_draw_buffers GLEW_GET_VAR(__GLEW_ARB_draw_buffers)
+
+#endif /* GL_ARB_draw_buffers */
+
+/* ------------------------ GL_ARB_fragment_program ------------------------ */
+
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+
+#define GL_FRAGMENT_PROGRAM_ARB 0x8804
+#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805
+#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806
+#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807
+#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808
+#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809
+#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A
+#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B
+#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C
+#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D
+#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E
+#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F
+#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810
+#define GL_MAX_TEXTURE_COORDS_ARB 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872
+
+#define GLEW_ARB_fragment_program GLEW_GET_VAR(__GLEW_ARB_fragment_program)
+
+#endif /* GL_ARB_fragment_program */
+
+/* --------------------- GL_ARB_fragment_program_shadow -------------------- */
+
+#ifndef GL_ARB_fragment_program_shadow
+#define GL_ARB_fragment_program_shadow 1
+
+#define GLEW_ARB_fragment_program_shadow GLEW_GET_VAR(__GLEW_ARB_fragment_program_shadow)
+
+#endif /* GL_ARB_fragment_program_shadow */
+
+/* ------------------------- GL_ARB_fragment_shader ------------------------ */
+
+#ifndef GL_ARB_fragment_shader
+#define GL_ARB_fragment_shader 1
+
+#define GL_FRAGMENT_SHADER_ARB 0x8B30
+#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49
+#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
+
+#define GLEW_ARB_fragment_shader GLEW_GET_VAR(__GLEW_ARB_fragment_shader)
+
+#endif /* GL_ARB_fragment_shader */
+
+/* ------------------------ GL_ARB_half_float_pixel ------------------------ */
+
+#ifndef GL_ARB_half_float_pixel
+#define GL_ARB_half_float_pixel 1
+
+#define GL_HALF_FLOAT_ARB 0x140B
+
+#define GLEW_ARB_half_float_pixel GLEW_GET_VAR(__GLEW_ARB_half_float_pixel)
+
+#endif /* GL_ARB_half_float_pixel */
+
+/* ----------------------------- GL_ARB_imaging ---------------------------- */
+
+#ifndef GL_ARB_imaging
+#define GL_ARB_imaging 1
+
+#define GL_CONSTANT_COLOR 0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002
+#define GL_CONSTANT_ALPHA 0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004
+#define GL_BLEND_COLOR 0x8005
+#define GL_FUNC_ADD 0x8006
+#define GL_MIN 0x8007
+#define GL_MAX 0x8008
+#define GL_BLEND_EQUATION 0x8009
+#define GL_FUNC_SUBTRACT 0x800A
+#define GL_FUNC_REVERSE_SUBTRACT 0x800B
+#define GL_CONVOLUTION_1D 0x8010
+#define GL_CONVOLUTION_2D 0x8011
+#define GL_SEPARABLE_2D 0x8012
+#define GL_CONVOLUTION_BORDER_MODE 0x8013
+#define GL_CONVOLUTION_FILTER_SCALE 0x8014
+#define GL_CONVOLUTION_FILTER_BIAS 0x8015
+#define GL_REDUCE 0x8016
+#define GL_CONVOLUTION_FORMAT 0x8017
+#define GL_CONVOLUTION_WIDTH 0x8018
+#define GL_CONVOLUTION_HEIGHT 0x8019
+#define GL_MAX_CONVOLUTION_WIDTH 0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT 0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE 0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS 0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023
+#define GL_HISTOGRAM 0x8024
+#define GL_PROXY_HISTOGRAM 0x8025
+#define GL_HISTOGRAM_WIDTH 0x8026
+#define GL_HISTOGRAM_FORMAT 0x8027
+#define GL_HISTOGRAM_RED_SIZE 0x8028
+#define GL_HISTOGRAM_GREEN_SIZE 0x8029
+#define GL_HISTOGRAM_BLUE_SIZE 0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE 0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C
+#define GL_HISTOGRAM_SINK 0x802D
+#define GL_MINMAX 0x802E
+#define GL_MINMAX_FORMAT 0x802F
+#define GL_MINMAX_SINK 0x8030
+#define GL_TABLE_TOO_LARGE 0x8031
+#define GL_COLOR_MATRIX 0x80B1
+#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2
+#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3
+#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4
+#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5
+#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6
+#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7
+#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8
+#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9
+#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA
+#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB
+#define GL_COLOR_TABLE 0x80D0
+#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1
+#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2
+#define GL_PROXY_COLOR_TABLE 0x80D3
+#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4
+#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5
+#define GL_COLOR_TABLE_SCALE 0x80D6
+#define GL_COLOR_TABLE_BIAS 0x80D7
+#define GL_COLOR_TABLE_FORMAT 0x80D8
+#define GL_COLOR_TABLE_WIDTH 0x80D9
+#define GL_COLOR_TABLE_RED_SIZE 0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF
+#define GL_IGNORE_BORDER 0x8150
+#define GL_CONSTANT_BORDER 0x8151
+#define GL_WRAP_BORDER 0x8152
+#define GL_REPLICATE_BORDER 0x8153
+#define GL_CONVOLUTION_BORDER_COLOR 0x8154
+
+typedef void (GLAPIENTRY * PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum types, GLvoid *values);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
+typedef void (GLAPIENTRY * PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
+typedef void (GLAPIENTRY * PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLRESETHISTOGRAMPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLRESETMINMAXPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
+
+#define glColorSubTable GLEW_GET_FUN(__glewColorSubTable)
+#define glColorTable GLEW_GET_FUN(__glewColorTable)
+#define glColorTableParameterfv GLEW_GET_FUN(__glewColorTableParameterfv)
+#define glColorTableParameteriv GLEW_GET_FUN(__glewColorTableParameteriv)
+#define glConvolutionFilter1D GLEW_GET_FUN(__glewConvolutionFilter1D)
+#define glConvolutionFilter2D GLEW_GET_FUN(__glewConvolutionFilter2D)
+#define glConvolutionParameterf GLEW_GET_FUN(__glewConvolutionParameterf)
+#define glConvolutionParameterfv GLEW_GET_FUN(__glewConvolutionParameterfv)
+#define glConvolutionParameteri GLEW_GET_FUN(__glewConvolutionParameteri)
+#define glConvolutionParameteriv GLEW_GET_FUN(__glewConvolutionParameteriv)
+#define glCopyColorSubTable GLEW_GET_FUN(__glewCopyColorSubTable)
+#define glCopyColorTable GLEW_GET_FUN(__glewCopyColorTable)
+#define glCopyConvolutionFilter1D GLEW_GET_FUN(__glewCopyConvolutionFilter1D)
+#define glCopyConvolutionFilter2D GLEW_GET_FUN(__glewCopyConvolutionFilter2D)
+#define glGetColorTable GLEW_GET_FUN(__glewGetColorTable)
+#define glGetColorTableParameterfv GLEW_GET_FUN(__glewGetColorTableParameterfv)
+#define glGetColorTableParameteriv GLEW_GET_FUN(__glewGetColorTableParameteriv)
+#define glGetConvolutionFilter GLEW_GET_FUN(__glewGetConvolutionFilter)
+#define glGetConvolutionParameterfv GLEW_GET_FUN(__glewGetConvolutionParameterfv)
+#define glGetConvolutionParameteriv GLEW_GET_FUN(__glewGetConvolutionParameteriv)
+#define glGetHistogram GLEW_GET_FUN(__glewGetHistogram)
+#define glGetHistogramParameterfv GLEW_GET_FUN(__glewGetHistogramParameterfv)
+#define glGetHistogramParameteriv GLEW_GET_FUN(__glewGetHistogramParameteriv)
+#define glGetMinmax GLEW_GET_FUN(__glewGetMinmax)
+#define glGetMinmaxParameterfv GLEW_GET_FUN(__glewGetMinmaxParameterfv)
+#define glGetMinmaxParameteriv GLEW_GET_FUN(__glewGetMinmaxParameteriv)
+#define glGetSeparableFilter GLEW_GET_FUN(__glewGetSeparableFilter)
+#define glHistogram GLEW_GET_FUN(__glewHistogram)
+#define glMinmax GLEW_GET_FUN(__glewMinmax)
+#define glResetHistogram GLEW_GET_FUN(__glewResetHistogram)
+#define glResetMinmax GLEW_GET_FUN(__glewResetMinmax)
+#define glSeparableFilter2D GLEW_GET_FUN(__glewSeparableFilter2D)
+
+#define GLEW_ARB_imaging GLEW_GET_VAR(__GLEW_ARB_imaging)
+
+#endif /* GL_ARB_imaging */
+
+/* ------------------------- GL_ARB_matrix_palette ------------------------- */
+
+#ifndef GL_ARB_matrix_palette
+#define GL_ARB_matrix_palette 1
+
+#define GL_MATRIX_PALETTE_ARB 0x8840
+#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841
+#define GL_MAX_PALETTE_MATRICES_ARB 0x8842
+#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843
+#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844
+#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845
+#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846
+#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847
+#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848
+#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849
+
+typedef void (GLAPIENTRY * PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, GLvoid *pointer);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUBVARBPROC) (GLint size, GLubyte *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUIVARBPROC) (GLint size, GLuint *indices);
+typedef void (GLAPIENTRY * PFNGLMATRIXINDEXUSVARBPROC) (GLint size, GLushort *indices);
+
+#define glCurrentPaletteMatrixARB GLEW_GET_FUN(__glewCurrentPaletteMatrixARB)
+#define glMatrixIndexPointerARB GLEW_GET_FUN(__glewMatrixIndexPointerARB)
+#define glMatrixIndexubvARB GLEW_GET_FUN(__glewMatrixIndexubvARB)
+#define glMatrixIndexuivARB GLEW_GET_FUN(__glewMatrixIndexuivARB)
+#define glMatrixIndexusvARB GLEW_GET_FUN(__glewMatrixIndexusvARB)
+
+#define GLEW_ARB_matrix_palette GLEW_GET_VAR(__GLEW_ARB_matrix_palette)
+
+#endif /* GL_ARB_matrix_palette */
+
+/* --------------------------- GL_ARB_multisample -------------------------- */
+
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+
+#define GL_MULTISAMPLE_ARB 0x809D
+#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F
+#define GL_SAMPLE_COVERAGE_ARB 0x80A0
+#define GL_SAMPLE_BUFFERS_ARB 0x80A8
+#define GL_SAMPLES_ARB 0x80A9
+#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA
+#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB
+#define GL_MULTISAMPLE_BIT_ARB 0x20000000
+
+typedef void (GLAPIENTRY * PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
+
+#define glSampleCoverageARB GLEW_GET_FUN(__glewSampleCoverageARB)
+
+#define GLEW_ARB_multisample GLEW_GET_VAR(__GLEW_ARB_multisample)
+
+#endif /* GL_ARB_multisample */
+
+/* -------------------------- GL_ARB_multitexture -------------------------- */
+
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+
+#define GL_TEXTURE0_ARB 0x84C0
+#define GL_TEXTURE1_ARB 0x84C1
+#define GL_TEXTURE2_ARB 0x84C2
+#define GL_TEXTURE3_ARB 0x84C3
+#define GL_TEXTURE4_ARB 0x84C4
+#define GL_TEXTURE5_ARB 0x84C5
+#define GL_TEXTURE6_ARB 0x84C6
+#define GL_TEXTURE7_ARB 0x84C7
+#define GL_TEXTURE8_ARB 0x84C8
+#define GL_TEXTURE9_ARB 0x84C9
+#define GL_TEXTURE10_ARB 0x84CA
+#define GL_TEXTURE11_ARB 0x84CB
+#define GL_TEXTURE12_ARB 0x84CC
+#define GL_TEXTURE13_ARB 0x84CD
+#define GL_TEXTURE14_ARB 0x84CE
+#define GL_TEXTURE15_ARB 0x84CF
+#define GL_TEXTURE16_ARB 0x84D0
+#define GL_TEXTURE17_ARB 0x84D1
+#define GL_TEXTURE18_ARB 0x84D2
+#define GL_TEXTURE19_ARB 0x84D3
+#define GL_TEXTURE20_ARB 0x84D4
+#define GL_TEXTURE21_ARB 0x84D5
+#define GL_TEXTURE22_ARB 0x84D6
+#define GL_TEXTURE23_ARB 0x84D7
+#define GL_TEXTURE24_ARB 0x84D8
+#define GL_TEXTURE25_ARB 0x84D9
+#define GL_TEXTURE26_ARB 0x84DA
+#define GL_TEXTURE27_ARB 0x84DB
+#define GL_TEXTURE28_ARB 0x84DC
+#define GL_TEXTURE29_ARB 0x84DD
+#define GL_TEXTURE30_ARB 0x84DE
+#define GL_TEXTURE31_ARB 0x84DF
+#define GL_ACTIVE_TEXTURE_ARB 0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1
+#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2
+
+typedef void (GLAPIENTRY * PFNGLACTIVETEXTUREARBPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
+
+#define glActiveTextureARB GLEW_GET_FUN(__glewActiveTextureARB)
+#define glClientActiveTextureARB GLEW_GET_FUN(__glewClientActiveTextureARB)
+#define glMultiTexCoord1dARB GLEW_GET_FUN(__glewMultiTexCoord1dARB)
+#define glMultiTexCoord1dvARB GLEW_GET_FUN(__glewMultiTexCoord1dvARB)
+#define glMultiTexCoord1fARB GLEW_GET_FUN(__glewMultiTexCoord1fARB)
+#define glMultiTexCoord1fvARB GLEW_GET_FUN(__glewMultiTexCoord1fvARB)
+#define glMultiTexCoord1iARB GLEW_GET_FUN(__glewMultiTexCoord1iARB)
+#define glMultiTexCoord1ivARB GLEW_GET_FUN(__glewMultiTexCoord1ivARB)
+#define glMultiTexCoord1sARB GLEW_GET_FUN(__glewMultiTexCoord1sARB)
+#define glMultiTexCoord1svARB GLEW_GET_FUN(__glewMultiTexCoord1svARB)
+#define glMultiTexCoord2dARB GLEW_GET_FUN(__glewMultiTexCoord2dARB)
+#define glMultiTexCoord2dvARB GLEW_GET_FUN(__glewMultiTexCoord2dvARB)
+#define glMultiTexCoord2fARB GLEW_GET_FUN(__glewMultiTexCoord2fARB)
+#define glMultiTexCoord2fvARB GLEW_GET_FUN(__glewMultiTexCoord2fvARB)
+#define glMultiTexCoord2iARB GLEW_GET_FUN(__glewMultiTexCoord2iARB)
+#define glMultiTexCoord2ivARB GLEW_GET_FUN(__glewMultiTexCoord2ivARB)
+#define glMultiTexCoord2sARB GLEW_GET_FUN(__glewMultiTexCoord2sARB)
+#define glMultiTexCoord2svARB GLEW_GET_FUN(__glewMultiTexCoord2svARB)
+#define glMultiTexCoord3dARB GLEW_GET_FUN(__glewMultiTexCoord3dARB)
+#define glMultiTexCoord3dvARB GLEW_GET_FUN(__glewMultiTexCoord3dvARB)
+#define glMultiTexCoord3fARB GLEW_GET_FUN(__glewMultiTexCoord3fARB)
+#define glMultiTexCoord3fvARB GLEW_GET_FUN(__glewMultiTexCoord3fvARB)
+#define glMultiTexCoord3iARB GLEW_GET_FUN(__glewMultiTexCoord3iARB)
+#define glMultiTexCoord3ivARB GLEW_GET_FUN(__glewMultiTexCoord3ivARB)
+#define glMultiTexCoord3sARB GLEW_GET_FUN(__glewMultiTexCoord3sARB)
+#define glMultiTexCoord3svARB GLEW_GET_FUN(__glewMultiTexCoord3svARB)
+#define glMultiTexCoord4dARB GLEW_GET_FUN(__glewMultiTexCoord4dARB)
+#define glMultiTexCoord4dvARB GLEW_GET_FUN(__glewMultiTexCoord4dvARB)
+#define glMultiTexCoord4fARB GLEW_GET_FUN(__glewMultiTexCoord4fARB)
+#define glMultiTexCoord4fvARB GLEW_GET_FUN(__glewMultiTexCoord4fvARB)
+#define glMultiTexCoord4iARB GLEW_GET_FUN(__glewMultiTexCoord4iARB)
+#define glMultiTexCoord4ivARB GLEW_GET_FUN(__glewMultiTexCoord4ivARB)
+#define glMultiTexCoord4sARB GLEW_GET_FUN(__glewMultiTexCoord4sARB)
+#define glMultiTexCoord4svARB GLEW_GET_FUN(__glewMultiTexCoord4svARB)
+
+#define GLEW_ARB_multitexture GLEW_GET_VAR(__GLEW_ARB_multitexture)
+
+#endif /* GL_ARB_multitexture */
+
+/* ------------------------- GL_ARB_occlusion_query ------------------------ */
+
+#ifndef GL_ARB_occlusion_query
+#define GL_ARB_occlusion_query 1
+
+#define GL_QUERY_COUNTER_BITS_ARB 0x8864
+#define GL_CURRENT_QUERY_ARB 0x8865
+#define GL_QUERY_RESULT_ARB 0x8866
+#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867
+#define GL_SAMPLES_PASSED_ARB 0x8914
+
+typedef void (GLAPIENTRY * PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDQUERYARBPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef void (GLAPIENTRY * PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISQUERYARBPROC) (GLuint id);
+
+#define glBeginQueryARB GLEW_GET_FUN(__glewBeginQueryARB)
+#define glDeleteQueriesARB GLEW_GET_FUN(__glewDeleteQueriesARB)
+#define glEndQueryARB GLEW_GET_FUN(__glewEndQueryARB)
+#define glGenQueriesARB GLEW_GET_FUN(__glewGenQueriesARB)
+#define glGetQueryObjectivARB GLEW_GET_FUN(__glewGetQueryObjectivARB)
+#define glGetQueryObjectuivARB GLEW_GET_FUN(__glewGetQueryObjectuivARB)
+#define glGetQueryivARB GLEW_GET_FUN(__glewGetQueryivARB)
+#define glIsQueryARB GLEW_GET_FUN(__glewIsQueryARB)
+
+#define GLEW_ARB_occlusion_query GLEW_GET_VAR(__GLEW_ARB_occlusion_query)
+
+#endif /* GL_ARB_occlusion_query */
+
+/* ----------------------- GL_ARB_pixel_buffer_object ---------------------- */
+
+#ifndef GL_ARB_pixel_buffer_object
+#define GL_ARB_pixel_buffer_object 1
+
+#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB
+#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC
+#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED
+#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF
+
+#define GLEW_ARB_pixel_buffer_object GLEW_GET_VAR(__GLEW_ARB_pixel_buffer_object)
+
+#endif /* GL_ARB_pixel_buffer_object */
+
+/* ------------------------ GL_ARB_point_parameters ------------------------ */
+
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+
+#define GL_POINT_SIZE_MIN_ARB 0x8126
+#define GL_POINT_SIZE_MAX_ARB 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128
+#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129
+
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, GLfloat* params);
+
+#define glPointParameterfARB GLEW_GET_FUN(__glewPointParameterfARB)
+#define glPointParameterfvARB GLEW_GET_FUN(__glewPointParameterfvARB)
+
+#define GLEW_ARB_point_parameters GLEW_GET_VAR(__GLEW_ARB_point_parameters)
+
+#endif /* GL_ARB_point_parameters */
+
+/* -------------------------- GL_ARB_point_sprite -------------------------- */
+
+#ifndef GL_ARB_point_sprite
+#define GL_ARB_point_sprite 1
+
+#define GL_POINT_SPRITE_ARB 0x8861
+#define GL_COORD_REPLACE_ARB 0x8862
+
+#define GLEW_ARB_point_sprite GLEW_GET_VAR(__GLEW_ARB_point_sprite)
+
+#endif /* GL_ARB_point_sprite */
+
+/* ------------------------- GL_ARB_shader_objects ------------------------- */
+
+#ifndef GL_ARB_shader_objects
+#define GL_ARB_shader_objects 1
+
+#define GL_PROGRAM_OBJECT_ARB 0x8B40
+#define GL_SHADER_OBJECT_ARB 0x8B48
+#define GL_OBJECT_TYPE_ARB 0x8B4E
+#define GL_OBJECT_SUBTYPE_ARB 0x8B4F
+#define GL_FLOAT_VEC2_ARB 0x8B50
+#define GL_FLOAT_VEC3_ARB 0x8B51
+#define GL_FLOAT_VEC4_ARB 0x8B52
+#define GL_INT_VEC2_ARB 0x8B53
+#define GL_INT_VEC3_ARB 0x8B54
+#define GL_INT_VEC4_ARB 0x8B55
+#define GL_BOOL_ARB 0x8B56
+#define GL_BOOL_VEC2_ARB 0x8B57
+#define GL_BOOL_VEC3_ARB 0x8B58
+#define GL_BOOL_VEC4_ARB 0x8B59
+#define GL_FLOAT_MAT2_ARB 0x8B5A
+#define GL_FLOAT_MAT3_ARB 0x8B5B
+#define GL_FLOAT_MAT4_ARB 0x8B5C
+#define GL_SAMPLER_1D_ARB 0x8B5D
+#define GL_SAMPLER_2D_ARB 0x8B5E
+#define GL_SAMPLER_3D_ARB 0x8B5F
+#define GL_SAMPLER_CUBE_ARB 0x8B60
+#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61
+#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64
+#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80
+#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81
+#define GL_OBJECT_LINK_STATUS_ARB 0x8B82
+#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83
+#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84
+#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85
+#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86
+#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87
+#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88
+
+typedef char GLcharARB;
+typedef unsigned int GLhandleARB;
+
+typedef void (GLAPIENTRY * PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
+typedef void (GLAPIENTRY * PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj);
+typedef GLhandleARB (GLAPIENTRY * PFNGLCREATEPROGRAMOBJECTARBPROC) (void);
+typedef GLhandleARB (GLAPIENTRY * PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType);
+typedef void (GLAPIENTRY * PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj);
+typedef void (GLAPIENTRY * PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei* length, GLint *size, GLenum *type, GLcharARB *name);
+typedef void (GLAPIENTRY * PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei* count, GLhandleARB *obj);
+typedef GLhandleARB (GLAPIENTRY * PFNGLGETHANDLEARBPROC) (GLenum pname);
+typedef void (GLAPIENTRY * PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *infoLog);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei* length, GLcharARB *source);
+typedef GLint (GLAPIENTRY * PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB* name);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint* params);
+typedef void (GLAPIENTRY * PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
+typedef void (GLAPIENTRY * PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB ** string, const GLint *length);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
+typedef void (GLAPIENTRY * PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
+typedef void (GLAPIENTRY * PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
+typedef void (GLAPIENTRY * PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
+typedef void (GLAPIENTRY * PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat* value);
+typedef void (GLAPIENTRY * PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj);
+typedef void (GLAPIENTRY * PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj);
+
+#define glAttachObjectARB GLEW_GET_FUN(__glewAttachObjectARB)
+#define glCompileShaderARB GLEW_GET_FUN(__glewCompileShaderARB)
+#define glCreateProgramObjectARB GLEW_GET_FUN(__glewCreateProgramObjectARB)
+#define glCreateShaderObjectARB GLEW_GET_FUN(__glewCreateShaderObjectARB)
+#define glDeleteObjectARB GLEW_GET_FUN(__glewDeleteObjectARB)
+#define glDetachObjectARB GLEW_GET_FUN(__glewDetachObjectARB)
+#define glGetActiveUniformARB GLEW_GET_FUN(__glewGetActiveUniformARB)
+#define glGetAttachedObjectsARB GLEW_GET_FUN(__glewGetAttachedObjectsARB)
+#define glGetHandleARB GLEW_GET_FUN(__glewGetHandleARB)
+#define glGetInfoLogARB GLEW_GET_FUN(__glewGetInfoLogARB)
+#define glGetObjectParameterfvARB GLEW_GET_FUN(__glewGetObjectParameterfvARB)
+#define glGetObjectParameterivARB GLEW_GET_FUN(__glewGetObjectParameterivARB)
+#define glGetShaderSourceARB GLEW_GET_FUN(__glewGetShaderSourceARB)
+#define glGetUniformLocationARB GLEW_GET_FUN(__glewGetUniformLocationARB)
+#define glGetUniformfvARB GLEW_GET_FUN(__glewGetUniformfvARB)
+#define glGetUniformivARB GLEW_GET_FUN(__glewGetUniformivARB)
+#define glLinkProgramARB GLEW_GET_FUN(__glewLinkProgramARB)
+#define glShaderSourceARB GLEW_GET_FUN(__glewShaderSourceARB)
+#define glUniform1fARB GLEW_GET_FUN(__glewUniform1fARB)
+#define glUniform1fvARB GLEW_GET_FUN(__glewUniform1fvARB)
+#define glUniform1iARB GLEW_GET_FUN(__glewUniform1iARB)
+#define glUniform1ivARB GLEW_GET_FUN(__glewUniform1ivARB)
+#define glUniform2fARB GLEW_GET_FUN(__glewUniform2fARB)
+#define glUniform2fvARB GLEW_GET_FUN(__glewUniform2fvARB)
+#define glUniform2iARB GLEW_GET_FUN(__glewUniform2iARB)
+#define glUniform2ivARB GLEW_GET_FUN(__glewUniform2ivARB)
+#define glUniform3fARB GLEW_GET_FUN(__glewUniform3fARB)
+#define glUniform3fvARB GLEW_GET_FUN(__glewUniform3fvARB)
+#define glUniform3iARB GLEW_GET_FUN(__glewUniform3iARB)
+#define glUniform3ivARB GLEW_GET_FUN(__glewUniform3ivARB)
+#define glUniform4fARB GLEW_GET_FUN(__glewUniform4fARB)
+#define glUniform4fvARB GLEW_GET_FUN(__glewUniform4fvARB)
+#define glUniform4iARB GLEW_GET_FUN(__glewUniform4iARB)
+#define glUniform4ivARB GLEW_GET_FUN(__glewUniform4ivARB)
+#define glUniformMatrix2fvARB GLEW_GET_FUN(__glewUniformMatrix2fvARB)
+#define glUniformMatrix3fvARB GLEW_GET_FUN(__glewUniformMatrix3fvARB)
+#define glUniformMatrix4fvARB GLEW_GET_FUN(__glewUniformMatrix4fvARB)
+#define glUseProgramObjectARB GLEW_GET_FUN(__glewUseProgramObjectARB)
+#define glValidateProgramARB GLEW_GET_FUN(__glewValidateProgramARB)
+
+#define GLEW_ARB_shader_objects GLEW_GET_VAR(__GLEW_ARB_shader_objects)
+
+#endif /* GL_ARB_shader_objects */
+
+/* ---------------------- GL_ARB_shading_language_100 ---------------------- */
+
+#ifndef GL_ARB_shading_language_100
+#define GL_ARB_shading_language_100 1
+
+#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C
+
+#define GLEW_ARB_shading_language_100 GLEW_GET_VAR(__GLEW_ARB_shading_language_100)
+
+#endif /* GL_ARB_shading_language_100 */
+
+/* ----------------------------- GL_ARB_shadow ----------------------------- */
+
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+
+#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C
+#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D
+#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E
+
+#define GLEW_ARB_shadow GLEW_GET_VAR(__GLEW_ARB_shadow)
+
+#endif /* GL_ARB_shadow */
+
+/* ------------------------- GL_ARB_shadow_ambient ------------------------- */
+
+#ifndef GL_ARB_shadow_ambient
+#define GL_ARB_shadow_ambient 1
+
+#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF
+
+#define GLEW_ARB_shadow_ambient GLEW_GET_VAR(__GLEW_ARB_shadow_ambient)
+
+#endif /* GL_ARB_shadow_ambient */
+
+/* ---------------------- GL_ARB_texture_border_clamp ---------------------- */
+
+#ifndef GL_ARB_texture_border_clamp
+#define GL_ARB_texture_border_clamp 1
+
+#define GL_CLAMP_TO_BORDER_ARB 0x812D
+
+#define GLEW_ARB_texture_border_clamp GLEW_GET_VAR(__GLEW_ARB_texture_border_clamp)
+
+#endif /* GL_ARB_texture_border_clamp */
+
+/* ----------------------- GL_ARB_texture_compression ---------------------- */
+
+#ifndef GL_ARB_texture_compression
+#define GL_ARB_texture_compression 1
+
+#define GL_COMPRESSED_ALPHA_ARB 0x84E9
+#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA
+#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB
+#define GL_COMPRESSED_INTENSITY_ARB 0x84EC
+#define GL_COMPRESSED_RGB_ARB 0x84ED
+#define GL_COMPRESSED_RGBA_ARB 0x84EE
+#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF
+#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0
+#define GL_TEXTURE_COMPRESSED_ARB 0x86A1
+#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2
+#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3
+
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const void* data);
+typedef void (GLAPIENTRY * PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, void* img);
+
+#define glCompressedTexImage1DARB GLEW_GET_FUN(__glewCompressedTexImage1DARB)
+#define glCompressedTexImage2DARB GLEW_GET_FUN(__glewCompressedTexImage2DARB)
+#define glCompressedTexImage3DARB GLEW_GET_FUN(__glewCompressedTexImage3DARB)
+#define glCompressedTexSubImage1DARB GLEW_GET_FUN(__glewCompressedTexSubImage1DARB)
+#define glCompressedTexSubImage2DARB GLEW_GET_FUN(__glewCompressedTexSubImage2DARB)
+#define glCompressedTexSubImage3DARB GLEW_GET_FUN(__glewCompressedTexSubImage3DARB)
+#define glGetCompressedTexImageARB GLEW_GET_FUN(__glewGetCompressedTexImageARB)
+
+#define GLEW_ARB_texture_compression GLEW_GET_VAR(__GLEW_ARB_texture_compression)
+
+#endif /* GL_ARB_texture_compression */
+
+/* ------------------------ GL_ARB_texture_cube_map ------------------------ */
+
+#ifndef GL_ARB_texture_cube_map
+#define GL_ARB_texture_cube_map 1
+
+#define GL_NORMAL_MAP_ARB 0x8511
+#define GL_REFLECTION_MAP_ARB 0x8512
+#define GL_TEXTURE_CUBE_MAP_ARB 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C
+
+#define GLEW_ARB_texture_cube_map GLEW_GET_VAR(__GLEW_ARB_texture_cube_map)
+
+#endif /* GL_ARB_texture_cube_map */
+
+/* ------------------------- GL_ARB_texture_env_add ------------------------ */
+
+#ifndef GL_ARB_texture_env_add
+#define GL_ARB_texture_env_add 1
+
+#define GLEW_ARB_texture_env_add GLEW_GET_VAR(__GLEW_ARB_texture_env_add)
+
+#endif /* GL_ARB_texture_env_add */
+
+/* ----------------------- GL_ARB_texture_env_combine ---------------------- */
+
+#ifndef GL_ARB_texture_env_combine
+#define GL_ARB_texture_env_combine 1
+
+#define GL_SUBTRACT_ARB 0x84E7
+#define GL_COMBINE_ARB 0x8570
+#define GL_COMBINE_RGB_ARB 0x8571
+#define GL_COMBINE_ALPHA_ARB 0x8572
+#define GL_RGB_SCALE_ARB 0x8573
+#define GL_ADD_SIGNED_ARB 0x8574
+#define GL_INTERPOLATE_ARB 0x8575
+#define GL_CONSTANT_ARB 0x8576
+#define GL_PRIMARY_COLOR_ARB 0x8577
+#define GL_PREVIOUS_ARB 0x8578
+#define GL_SOURCE0_RGB_ARB 0x8580
+#define GL_SOURCE1_RGB_ARB 0x8581
+#define GL_SOURCE2_RGB_ARB 0x8582
+#define GL_SOURCE0_ALPHA_ARB 0x8588
+#define GL_SOURCE1_ALPHA_ARB 0x8589
+#define GL_SOURCE2_ALPHA_ARB 0x858A
+#define GL_OPERAND0_RGB_ARB 0x8590
+#define GL_OPERAND1_RGB_ARB 0x8591
+#define GL_OPERAND2_RGB_ARB 0x8592
+#define GL_OPERAND0_ALPHA_ARB 0x8598
+#define GL_OPERAND1_ALPHA_ARB 0x8599
+#define GL_OPERAND2_ALPHA_ARB 0x859A
+
+#define GLEW_ARB_texture_env_combine GLEW_GET_VAR(__GLEW_ARB_texture_env_combine)
+
+#endif /* GL_ARB_texture_env_combine */
+
+/* ---------------------- GL_ARB_texture_env_crossbar ---------------------- */
+
+#ifndef GL_ARB_texture_env_crossbar
+#define GL_ARB_texture_env_crossbar 1
+
+#define GLEW_ARB_texture_env_crossbar GLEW_GET_VAR(__GLEW_ARB_texture_env_crossbar)
+
+#endif /* GL_ARB_texture_env_crossbar */
+
+/* ------------------------ GL_ARB_texture_env_dot3 ------------------------ */
+
+#ifndef GL_ARB_texture_env_dot3
+#define GL_ARB_texture_env_dot3 1
+
+#define GL_DOT3_RGB_ARB 0x86AE
+#define GL_DOT3_RGBA_ARB 0x86AF
+
+#define GLEW_ARB_texture_env_dot3 GLEW_GET_VAR(__GLEW_ARB_texture_env_dot3)
+
+#endif /* GL_ARB_texture_env_dot3 */
+
+/* -------------------------- GL_ARB_texture_float ------------------------- */
+
+#ifndef GL_ARB_texture_float
+#define GL_ARB_texture_float 1
+
+#define GL_RGBA32F_ARB 0x8814
+#define GL_RGB32F_ARB 0x8815
+#define GL_ALPHA32F_ARB 0x8816
+#define GL_INTENSITY32F_ARB 0x8817
+#define GL_LUMINANCE32F_ARB 0x8818
+#define GL_LUMINANCE_ALPHA32F_ARB 0x8819
+#define GL_RGBA16F_ARB 0x881A
+#define GL_RGB16F_ARB 0x881B
+#define GL_ALPHA16F_ARB 0x881C
+#define GL_INTENSITY16F_ARB 0x881D
+#define GL_LUMINANCE16F_ARB 0x881E
+#define GL_LUMINANCE_ALPHA16F_ARB 0x881F
+#define GL_TEXTURE_RED_TYPE_ARB 0x8C10
+#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11
+#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12
+#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13
+#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14
+#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15
+#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16
+#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17
+
+#define GLEW_ARB_texture_float GLEW_GET_VAR(__GLEW_ARB_texture_float)
+
+#endif /* GL_ARB_texture_float */
+
+/* --------------------- GL_ARB_texture_mirrored_repeat -------------------- */
+
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_ARB_texture_mirrored_repeat 1
+
+#define GL_MIRRORED_REPEAT_ARB 0x8370
+
+#define GLEW_ARB_texture_mirrored_repeat GLEW_GET_VAR(__GLEW_ARB_texture_mirrored_repeat)
+
+#endif /* GL_ARB_texture_mirrored_repeat */
+
+/* -------------------- GL_ARB_texture_non_power_of_two -------------------- */
+
+#ifndef GL_ARB_texture_non_power_of_two
+#define GL_ARB_texture_non_power_of_two 1
+
+#define GLEW_ARB_texture_non_power_of_two GLEW_GET_VAR(__GLEW_ARB_texture_non_power_of_two)
+
+#endif /* GL_ARB_texture_non_power_of_two */
+
+/* ------------------------ GL_ARB_texture_rectangle ----------------------- */
+
+#ifndef GL_ARB_texture_rectangle
+#define GL_ARB_texture_rectangle 1
+
+#define GL_TEXTURE_RECTANGLE_ARB 0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8
+#define GL_SAMPLER_2D_RECT_ARB 0x8B63
+#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64
+
+#define GLEW_ARB_texture_rectangle GLEW_GET_VAR(__GLEW_ARB_texture_rectangle)
+
+#endif /* GL_ARB_texture_rectangle */
+
+/* ------------------------ GL_ARB_transpose_matrix ------------------------ */
+
+#ifndef GL_ARB_transpose_matrix
+#define GL_ARB_transpose_matrix 1
+
+#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3
+#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4
+#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5
+#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6
+
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXDARBPROC) (GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLLOADTRANSPOSEMATRIXFARBPROC) (GLfloat m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXDARBPROC) (GLdouble m[16]);
+typedef void (GLAPIENTRY * PFNGLMULTTRANSPOSEMATRIXFARBPROC) (GLfloat m[16]);
+
+#define glLoadTransposeMatrixdARB GLEW_GET_FUN(__glewLoadTransposeMatrixdARB)
+#define glLoadTransposeMatrixfARB GLEW_GET_FUN(__glewLoadTransposeMatrixfARB)
+#define glMultTransposeMatrixdARB GLEW_GET_FUN(__glewMultTransposeMatrixdARB)
+#define glMultTransposeMatrixfARB GLEW_GET_FUN(__glewMultTransposeMatrixfARB)
+
+#define GLEW_ARB_transpose_matrix GLEW_GET_VAR(__GLEW_ARB_transpose_matrix)
+
+#endif /* GL_ARB_transpose_matrix */
+
+/* -------------------------- GL_ARB_vertex_blend -------------------------- */
+
+#ifndef GL_ARB_vertex_blend
+#define GL_ARB_vertex_blend 1
+
+#define GL_MODELVIEW0_ARB 0x1700
+#define GL_MODELVIEW1_ARB 0x850A
+#define GL_MAX_VERTEX_UNITS_ARB 0x86A4
+#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5
+#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6
+#define GL_VERTEX_BLEND_ARB 0x86A7
+#define GL_CURRENT_WEIGHT_ARB 0x86A8
+#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9
+#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA
+#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB
+#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC
+#define GL_WEIGHT_ARRAY_ARB 0x86AD
+#define GL_MODELVIEW2_ARB 0x8722
+#define GL_MODELVIEW3_ARB 0x8723
+#define GL_MODELVIEW4_ARB 0x8724
+#define GL_MODELVIEW5_ARB 0x8725
+#define GL_MODELVIEW6_ARB 0x8726
+#define GL_MODELVIEW7_ARB 0x8727
+#define GL_MODELVIEW8_ARB 0x8728
+#define GL_MODELVIEW9_ARB 0x8729
+#define GL_MODELVIEW10_ARB 0x872A
+#define GL_MODELVIEW11_ARB 0x872B
+#define GL_MODELVIEW12_ARB 0x872C
+#define GL_MODELVIEW13_ARB 0x872D
+#define GL_MODELVIEW14_ARB 0x872E
+#define GL_MODELVIEW15_ARB 0x872F
+#define GL_MODELVIEW16_ARB 0x8730
+#define GL_MODELVIEW17_ARB 0x8731
+#define GL_MODELVIEW18_ARB 0x8732
+#define GL_MODELVIEW19_ARB 0x8733
+#define GL_MODELVIEW20_ARB 0x8734
+#define GL_MODELVIEW21_ARB 0x8735
+#define GL_MODELVIEW22_ARB 0x8736
+#define GL_MODELVIEW23_ARB 0x8737
+#define GL_MODELVIEW24_ARB 0x8738
+#define GL_MODELVIEW25_ARB 0x8739
+#define GL_MODELVIEW26_ARB 0x873A
+#define GL_MODELVIEW27_ARB 0x873B
+#define GL_MODELVIEW28_ARB 0x873C
+#define GL_MODELVIEW29_ARB 0x873D
+#define GL_MODELVIEW30_ARB 0x873E
+#define GL_MODELVIEW31_ARB 0x873F
+
+typedef void (GLAPIENTRY * PFNGLVERTEXBLENDARBPROC) (GLint count);
+typedef void (GLAPIENTRY * PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, GLvoid *pointer);
+typedef void (GLAPIENTRY * PFNGLWEIGHTBVARBPROC) (GLint size, GLbyte *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTDVARBPROC) (GLint size, GLdouble *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTFVARBPROC) (GLint size, GLfloat *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTIVARBPROC) (GLint size, GLint *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTSVARBPROC) (GLint size, GLshort *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUBVARBPROC) (GLint size, GLubyte *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUIVARBPROC) (GLint size, GLuint *weights);
+typedef void (GLAPIENTRY * PFNGLWEIGHTUSVARBPROC) (GLint size, GLushort *weights);
+
+#define glVertexBlendARB GLEW_GET_FUN(__glewVertexBlendARB)
+#define glWeightPointerARB GLEW_GET_FUN(__glewWeightPointerARB)
+#define glWeightbvARB GLEW_GET_FUN(__glewWeightbvARB)
+#define glWeightdvARB GLEW_GET_FUN(__glewWeightdvARB)
+#define glWeightfvARB GLEW_GET_FUN(__glewWeightfvARB)
+#define glWeightivARB GLEW_GET_FUN(__glewWeightivARB)
+#define glWeightsvARB GLEW_GET_FUN(__glewWeightsvARB)
+#define glWeightubvARB GLEW_GET_FUN(__glewWeightubvARB)
+#define glWeightuivARB GLEW_GET_FUN(__glewWeightuivARB)
+#define glWeightusvARB GLEW_GET_FUN(__glewWeightusvARB)
+
+#define GLEW_ARB_vertex_blend GLEW_GET_VAR(__GLEW_ARB_vertex_blend)
+
+#endif /* GL_ARB_vertex_blend */
+
+/* ---------------------- GL_ARB_vertex_buffer_object ---------------------- */
+
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARB_vertex_buffer_object 1
+
+#define GL_BUFFER_SIZE_ARB 0x8764
+#define GL_BUFFER_USAGE_ARB 0x8765
+#define GL_ARRAY_BUFFER_ARB 0x8892
+#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893
+#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894
+#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895
+#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896
+#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897
+#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898
+#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899
+#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A
+#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B
+#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C
+#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D
+#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E
+#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F
+#define GL_READ_ONLY_ARB 0x88B8
+#define GL_WRITE_ONLY_ARB 0x88B9
+#define GL_READ_WRITE_ARB 0x88BA
+#define GL_BUFFER_ACCESS_ARB 0x88BB
+#define GL_BUFFER_MAPPED_ARB 0x88BC
+#define GL_BUFFER_MAP_POINTER_ARB 0x88BD
+#define GL_STREAM_DRAW_ARB 0x88E0
+#define GL_STREAM_READ_ARB 0x88E1
+#define GL_STREAM_COPY_ARB 0x88E2
+#define GL_STATIC_DRAW_ARB 0x88E4
+#define GL_STATIC_READ_ARB 0x88E5
+#define GL_STATIC_COPY_ARB 0x88E6
+#define GL_DYNAMIC_DRAW_ARB 0x88E8
+#define GL_DYNAMIC_READ_ARB 0x88E9
+#define GL_DYNAMIC_COPY_ARB 0x88EA
+
+typedef ptrdiff_t GLsizeiptrARB;
+typedef ptrdiff_t GLintptrARB;
+
+typedef void (GLAPIENTRY * PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid* data, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid* data);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint* buffers);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid** params);
+typedef void (GLAPIENTRY * PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid* data);
+typedef GLboolean (GLAPIENTRY * PFNGLISBUFFERARBPROC) (GLuint buffer);
+typedef GLvoid * (GLAPIENTRY * PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
+typedef GLboolean (GLAPIENTRY * PFNGLUNMAPBUFFERARBPROC) (GLenum target);
+
+#define glBindBufferARB GLEW_GET_FUN(__glewBindBufferARB)
+#define glBufferDataARB GLEW_GET_FUN(__glewBufferDataARB)
+#define glBufferSubDataARB GLEW_GET_FUN(__glewBufferSubDataARB)
+#define glDeleteBuffersARB GLEW_GET_FUN(__glewDeleteBuffersARB)
+#define glGenBuffersARB GLEW_GET_FUN(__glewGenBuffersARB)
+#define glGetBufferParameterivARB GLEW_GET_FUN(__glewGetBufferParameterivARB)
+#define glGetBufferPointervARB GLEW_GET_FUN(__glewGetBufferPointervARB)
+#define glGetBufferSubDataARB GLEW_GET_FUN(__glewGetBufferSubDataARB)
+#define glIsBufferARB GLEW_GET_FUN(__glewIsBufferARB)
+#define glMapBufferARB GLEW_GET_FUN(__glewMapBufferARB)
+#define glUnmapBufferARB GLEW_GET_FUN(__glewUnmapBufferARB)
+
+#define GLEW_ARB_vertex_buffer_object GLEW_GET_VAR(__GLEW_ARB_vertex_buffer_object)
+
+#endif /* GL_ARB_vertex_buffer_object */
+
+/* ------------------------- GL_ARB_vertex_program ------------------------- */
+
+#ifndef GL_ARB_vertex_program
+#define GL_ARB_vertex_program 1
+
+#define GL_COLOR_SUM_ARB 0x8458
+#define GL_VERTEX_PROGRAM_ARB 0x8620
+#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622
+#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623
+#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624
+#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625
+#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626
+#define GL_PROGRAM_LENGTH_ARB 0x8627
+#define GL_PROGRAM_STRING_ARB 0x8628
+#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E
+#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F
+#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640
+#define GL_CURRENT_MATRIX_ARB 0x8641
+#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643
+#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645
+#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B
+#define GL_PROGRAM_BINDING_ARB 0x8677
+#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869
+#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A
+#define GL_PROGRAM_ERROR_STRING_ARB 0x8874
+#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875
+#define GL_PROGRAM_FORMAT_ARB 0x8876
+#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0
+#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1
+#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2
+#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3
+#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4
+#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5
+#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6
+#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7
+#define GL_PROGRAM_PARAMETERS_ARB 0x88A8
+#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9
+#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA
+#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB
+#define GL_PROGRAM_ATTRIBS_ARB 0x88AC
+#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD
+#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE
+#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF
+#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0
+#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1
+#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2
+#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3
+#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4
+#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5
+#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6
+#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7
+#define GL_MATRIX0_ARB 0x88C0
+#define GL_MATRIX1_ARB 0x88C1
+#define GL_MATRIX2_ARB 0x88C2
+#define GL_MATRIX3_ARB 0x88C3
+#define GL_MATRIX4_ARB 0x88C4
+#define GL_MATRIX5_ARB 0x88C5
+#define GL_MATRIX6_ARB 0x88C6
+#define GL_MATRIX7_ARB 0x88C7
+#define GL_MATRIX8_ARB 0x88C8
+#define GL_MATRIX9_ARB 0x88C9
+#define GL_MATRIX10_ARB 0x88CA
+#define GL_MATRIX11_ARB 0x88CB
+#define GL_MATRIX12_ARB 0x88CC
+#define GL_MATRIX13_ARB 0x88CD
+#define GL_MATRIX14_ARB 0x88CE
+#define GL_MATRIX15_ARB 0x88CF
+#define GL_MATRIX16_ARB 0x88D0
+#define GL_MATRIX17_ARB 0x88D1
+#define GL_MATRIX18_ARB 0x88D2
+#define GL_MATRIX19_ARB 0x88D3
+#define GL_MATRIX20_ARB 0x88D4
+#define GL_MATRIX21_ARB 0x88D5
+#define GL_MATRIX22_ARB 0x88D6
+#define GL_MATRIX23_ARB 0x88D7
+#define GL_MATRIX24_ARB 0x88D8
+#define GL_MATRIX25_ARB 0x88D9
+#define GL_MATRIX26_ARB 0x88DA
+#define GL_MATRIX27_ARB 0x88DB
+#define GL_MATRIX28_ARB 0x88DC
+#define GL_MATRIX29_ARB 0x88DD
+#define GL_MATRIX30_ARB 0x88DE
+#define GL_MATRIX31_ARB 0x88DF
+
+typedef void (GLAPIENTRY * PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint* programs);
+typedef void (GLAPIENTRY * PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
+typedef void (GLAPIENTRY * PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
+typedef void (GLAPIENTRY * PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint* programs);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, void* string);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid** pointer);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMARBPROC) (GLuint program);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const void* string);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void* pointer);
+
+#define glBindProgramARB GLEW_GET_FUN(__glewBindProgramARB)
+#define glDeleteProgramsARB GLEW_GET_FUN(__glewDeleteProgramsARB)
+#define glDisableVertexAttribArrayARB GLEW_GET_FUN(__glewDisableVertexAttribArrayARB)
+#define glEnableVertexAttribArrayARB GLEW_GET_FUN(__glewEnableVertexAttribArrayARB)
+#define glGenProgramsARB GLEW_GET_FUN(__glewGenProgramsARB)
+#define glGetProgramEnvParameterdvARB GLEW_GET_FUN(__glewGetProgramEnvParameterdvARB)
+#define glGetProgramEnvParameterfvARB GLEW_GET_FUN(__glewGetProgramEnvParameterfvARB)
+#define glGetProgramLocalParameterdvARB GLEW_GET_FUN(__glewGetProgramLocalParameterdvARB)
+#define glGetProgramLocalParameterfvARB GLEW_GET_FUN(__glewGetProgramLocalParameterfvARB)
+#define glGetProgramStringARB GLEW_GET_FUN(__glewGetProgramStringARB)
+#define glGetProgramivARB GLEW_GET_FUN(__glewGetProgramivARB)
+#define glGetVertexAttribPointervARB GLEW_GET_FUN(__glewGetVertexAttribPointervARB)
+#define glGetVertexAttribdvARB GLEW_GET_FUN(__glewGetVertexAttribdvARB)
+#define glGetVertexAttribfvARB GLEW_GET_FUN(__glewGetVertexAttribfvARB)
+#define glGetVertexAttribivARB GLEW_GET_FUN(__glewGetVertexAttribivARB)
+#define glIsProgramARB GLEW_GET_FUN(__glewIsProgramARB)
+#define glProgramEnvParameter4dARB GLEW_GET_FUN(__glewProgramEnvParameter4dARB)
+#define glProgramEnvParameter4dvARB GLEW_GET_FUN(__glewProgramEnvParameter4dvARB)
+#define glProgramEnvParameter4fARB GLEW_GET_FUN(__glewProgramEnvParameter4fARB)
+#define glProgramEnvParameter4fvARB GLEW_GET_FUN(__glewProgramEnvParameter4fvARB)
+#define glProgramLocalParameter4dARB GLEW_GET_FUN(__glewProgramLocalParameter4dARB)
+#define glProgramLocalParameter4dvARB GLEW_GET_FUN(__glewProgramLocalParameter4dvARB)
+#define glProgramLocalParameter4fARB GLEW_GET_FUN(__glewProgramLocalParameter4fARB)
+#define glProgramLocalParameter4fvARB GLEW_GET_FUN(__glewProgramLocalParameter4fvARB)
+#define glProgramStringARB GLEW_GET_FUN(__glewProgramStringARB)
+#define glVertexAttrib1dARB GLEW_GET_FUN(__glewVertexAttrib1dARB)
+#define glVertexAttrib1dvARB GLEW_GET_FUN(__glewVertexAttrib1dvARB)
+#define glVertexAttrib1fARB GLEW_GET_FUN(__glewVertexAttrib1fARB)
+#define glVertexAttrib1fvARB GLEW_GET_FUN(__glewVertexAttrib1fvARB)
+#define glVertexAttrib1sARB GLEW_GET_FUN(__glewVertexAttrib1sARB)
+#define glVertexAttrib1svARB GLEW_GET_FUN(__glewVertexAttrib1svARB)
+#define glVertexAttrib2dARB GLEW_GET_FUN(__glewVertexAttrib2dARB)
+#define glVertexAttrib2dvARB GLEW_GET_FUN(__glewVertexAttrib2dvARB)
+#define glVertexAttrib2fARB GLEW_GET_FUN(__glewVertexAttrib2fARB)
+#define glVertexAttrib2fvARB GLEW_GET_FUN(__glewVertexAttrib2fvARB)
+#define glVertexAttrib2sARB GLEW_GET_FUN(__glewVertexAttrib2sARB)
+#define glVertexAttrib2svARB GLEW_GET_FUN(__glewVertexAttrib2svARB)
+#define glVertexAttrib3dARB GLEW_GET_FUN(__glewVertexAttrib3dARB)
+#define glVertexAttrib3dvARB GLEW_GET_FUN(__glewVertexAttrib3dvARB)
+#define glVertexAttrib3fARB GLEW_GET_FUN(__glewVertexAttrib3fARB)
+#define glVertexAttrib3fvARB GLEW_GET_FUN(__glewVertexAttrib3fvARB)
+#define glVertexAttrib3sARB GLEW_GET_FUN(__glewVertexAttrib3sARB)
+#define glVertexAttrib3svARB GLEW_GET_FUN(__glewVertexAttrib3svARB)
+#define glVertexAttrib4NbvARB GLEW_GET_FUN(__glewVertexAttrib4NbvARB)
+#define glVertexAttrib4NivARB GLEW_GET_FUN(__glewVertexAttrib4NivARB)
+#define glVertexAttrib4NsvARB GLEW_GET_FUN(__glewVertexAttrib4NsvARB)
+#define glVertexAttrib4NubARB GLEW_GET_FUN(__glewVertexAttrib4NubARB)
+#define glVertexAttrib4NubvARB GLEW_GET_FUN(__glewVertexAttrib4NubvARB)
+#define glVertexAttrib4NuivARB GLEW_GET_FUN(__glewVertexAttrib4NuivARB)
+#define glVertexAttrib4NusvARB GLEW_GET_FUN(__glewVertexAttrib4NusvARB)
+#define glVertexAttrib4bvARB GLEW_GET_FUN(__glewVertexAttrib4bvARB)
+#define glVertexAttrib4dARB GLEW_GET_FUN(__glewVertexAttrib4dARB)
+#define glVertexAttrib4dvARB GLEW_GET_FUN(__glewVertexAttrib4dvARB)
+#define glVertexAttrib4fARB GLEW_GET_FUN(__glewVertexAttrib4fARB)
+#define glVertexAttrib4fvARB GLEW_GET_FUN(__glewVertexAttrib4fvARB)
+#define glVertexAttrib4ivARB GLEW_GET_FUN(__glewVertexAttrib4ivARB)
+#define glVertexAttrib4sARB GLEW_GET_FUN(__glewVertexAttrib4sARB)
+#define glVertexAttrib4svARB GLEW_GET_FUN(__glewVertexAttrib4svARB)
+#define glVertexAttrib4ubvARB GLEW_GET_FUN(__glewVertexAttrib4ubvARB)
+#define glVertexAttrib4uivARB GLEW_GET_FUN(__glewVertexAttrib4uivARB)
+#define glVertexAttrib4usvARB GLEW_GET_FUN(__glewVertexAttrib4usvARB)
+#define glVertexAttribPointerARB GLEW_GET_FUN(__glewVertexAttribPointerARB)
+
+#define GLEW_ARB_vertex_program GLEW_GET_VAR(__GLEW_ARB_vertex_program)
+
+#endif /* GL_ARB_vertex_program */
+
+/* -------------------------- GL_ARB_vertex_shader ------------------------- */
+
+#ifndef GL_ARB_vertex_shader
+#define GL_ARB_vertex_shader 1
+
+#define GL_VERTEX_SHADER_ARB 0x8B31
+#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A
+#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B
+#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C
+#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D
+#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89
+#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A
+
+typedef void (GLAPIENTRY * PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB* name);
+typedef void (GLAPIENTRY * PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei* length, GLint *size, GLenum *type, GLcharARB *name);
+typedef GLint (GLAPIENTRY * PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB* name);
+
+#define glBindAttribLocationARB GLEW_GET_FUN(__glewBindAttribLocationARB)
+#define glGetActiveAttribARB GLEW_GET_FUN(__glewGetActiveAttribARB)
+#define glGetAttribLocationARB GLEW_GET_FUN(__glewGetAttribLocationARB)
+
+#define GLEW_ARB_vertex_shader GLEW_GET_VAR(__GLEW_ARB_vertex_shader)
+
+#endif /* GL_ARB_vertex_shader */
+
+/* --------------------------- GL_ARB_window_pos --------------------------- */
+
+#ifndef GL_ARB_window_pos
+#define GL_ARB_window_pos 1
+
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVARBPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVARBPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVARBPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVARBPROC) (const GLshort* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVARBPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVARBPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVARBPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVARBPROC) (const GLshort* p);
+
+#define glWindowPos2dARB GLEW_GET_FUN(__glewWindowPos2dARB)
+#define glWindowPos2dvARB GLEW_GET_FUN(__glewWindowPos2dvARB)
+#define glWindowPos2fARB GLEW_GET_FUN(__glewWindowPos2fARB)
+#define glWindowPos2fvARB GLEW_GET_FUN(__glewWindowPos2fvARB)
+#define glWindowPos2iARB GLEW_GET_FUN(__glewWindowPos2iARB)
+#define glWindowPos2ivARB GLEW_GET_FUN(__glewWindowPos2ivARB)
+#define glWindowPos2sARB GLEW_GET_FUN(__glewWindowPos2sARB)
+#define glWindowPos2svARB GLEW_GET_FUN(__glewWindowPos2svARB)
+#define glWindowPos3dARB GLEW_GET_FUN(__glewWindowPos3dARB)
+#define glWindowPos3dvARB GLEW_GET_FUN(__glewWindowPos3dvARB)
+#define glWindowPos3fARB GLEW_GET_FUN(__glewWindowPos3fARB)
+#define glWindowPos3fvARB GLEW_GET_FUN(__glewWindowPos3fvARB)
+#define glWindowPos3iARB GLEW_GET_FUN(__glewWindowPos3iARB)
+#define glWindowPos3ivARB GLEW_GET_FUN(__glewWindowPos3ivARB)
+#define glWindowPos3sARB GLEW_GET_FUN(__glewWindowPos3sARB)
+#define glWindowPos3svARB GLEW_GET_FUN(__glewWindowPos3svARB)
+
+#define GLEW_ARB_window_pos GLEW_GET_VAR(__GLEW_ARB_window_pos)
+
+#endif /* GL_ARB_window_pos */
+
+/* ------------------------- GL_ATIX_point_sprites ------------------------- */
+
+#ifndef GL_ATIX_point_sprites
+#define GL_ATIX_point_sprites 1
+
+#define GLEW_ATIX_point_sprites GLEW_GET_VAR(__GLEW_ATIX_point_sprites)
+
+#endif /* GL_ATIX_point_sprites */
+
+/* ---------------------- GL_ATIX_texture_env_combine3 --------------------- */
+
+#ifndef GL_ATIX_texture_env_combine3
+#define GL_ATIX_texture_env_combine3 1
+
+#define GL_MODULATE_ADD_ATIX 0x8744
+#define GL_MODULATE_SIGNED_ADD_ATIX 0x8745
+#define GL_MODULATE_SUBTRACT_ATIX 0x8746
+
+#define GLEW_ATIX_texture_env_combine3 GLEW_GET_VAR(__GLEW_ATIX_texture_env_combine3)
+
+#endif /* GL_ATIX_texture_env_combine3 */
+
+/* ----------------------- GL_ATIX_texture_env_route ----------------------- */
+
+#ifndef GL_ATIX_texture_env_route
+#define GL_ATIX_texture_env_route 1
+
+#define GL_SECONDARY_COLOR_ATIX 0x8747
+#define GL_TEXTURE_OUTPUT_RGB_ATIX 0x8748
+#define GL_TEXTURE_OUTPUT_ALPHA_ATIX 0x8749
+
+#define GLEW_ATIX_texture_env_route GLEW_GET_VAR(__GLEW_ATIX_texture_env_route)
+
+#endif /* GL_ATIX_texture_env_route */
+
+/* ---------------- GL_ATIX_vertex_shader_output_point_size ---------------- */
+
+#ifndef GL_ATIX_vertex_shader_output_point_size
+#define GL_ATIX_vertex_shader_output_point_size 1
+
+#define GL_OUTPUT_POINT_SIZE_ATIX 0x610E
+
+#define GLEW_ATIX_vertex_shader_output_point_size GLEW_GET_VAR(__GLEW_ATIX_vertex_shader_output_point_size)
+
+#endif /* GL_ATIX_vertex_shader_output_point_size */
+
+/* -------------------------- GL_ATI_draw_buffers -------------------------- */
+
+#ifndef GL_ATI_draw_buffers
+#define GL_ATI_draw_buffers 1
+
+#define GL_MAX_DRAW_BUFFERS_ATI 0x8824
+#define GL_DRAW_BUFFER0_ATI 0x8825
+#define GL_DRAW_BUFFER1_ATI 0x8826
+#define GL_DRAW_BUFFER2_ATI 0x8827
+#define GL_DRAW_BUFFER3_ATI 0x8828
+#define GL_DRAW_BUFFER4_ATI 0x8829
+#define GL_DRAW_BUFFER5_ATI 0x882A
+#define GL_DRAW_BUFFER6_ATI 0x882B
+#define GL_DRAW_BUFFER7_ATI 0x882C
+#define GL_DRAW_BUFFER8_ATI 0x882D
+#define GL_DRAW_BUFFER9_ATI 0x882E
+#define GL_DRAW_BUFFER10_ATI 0x882F
+#define GL_DRAW_BUFFER11_ATI 0x8830
+#define GL_DRAW_BUFFER12_ATI 0x8831
+#define GL_DRAW_BUFFER13_ATI 0x8832
+#define GL_DRAW_BUFFER14_ATI 0x8833
+#define GL_DRAW_BUFFER15_ATI 0x8834
+
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum* bufs);
+
+#define glDrawBuffersATI GLEW_GET_FUN(__glewDrawBuffersATI)
+
+#define GLEW_ATI_draw_buffers GLEW_GET_VAR(__GLEW_ATI_draw_buffers)
+
+#endif /* GL_ATI_draw_buffers */
+
+/* -------------------------- GL_ATI_element_array ------------------------- */
+
+#ifndef GL_ATI_element_array
+#define GL_ATI_element_array 1
+
+#define GL_ELEMENT_ARRAY_ATI 0x8768
+#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769
+#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A
+
+typedef void (GLAPIENTRY * PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLELEMENTPOINTERATIPROC) (GLenum type, const void* pointer);
+
+#define glDrawElementArrayATI GLEW_GET_FUN(__glewDrawElementArrayATI)
+#define glDrawRangeElementArrayATI GLEW_GET_FUN(__glewDrawRangeElementArrayATI)
+#define glElementPointerATI GLEW_GET_FUN(__glewElementPointerATI)
+
+#define GLEW_ATI_element_array GLEW_GET_VAR(__GLEW_ATI_element_array)
+
+#endif /* GL_ATI_element_array */
+
+/* ------------------------- GL_ATI_envmap_bumpmap ------------------------- */
+
+#ifndef GL_ATI_envmap_bumpmap
+#define GL_ATI_envmap_bumpmap 1
+
+#define GL_BUMP_ROT_MATRIX_ATI 0x8775
+#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776
+#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777
+#define GL_BUMP_TEX_UNITS_ATI 0x8778
+#define GL_DUDV_ATI 0x8779
+#define GL_DU8DV8_ATI 0x877A
+#define GL_BUMP_ENVMAP_ATI 0x877B
+#define GL_BUMP_TARGET_ATI 0x877C
+
+typedef void (GLAPIENTRY * PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
+typedef void (GLAPIENTRY * PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
+typedef void (GLAPIENTRY * PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
+typedef void (GLAPIENTRY * PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
+
+#define glGetTexBumpParameterfvATI GLEW_GET_FUN(__glewGetTexBumpParameterfvATI)
+#define glGetTexBumpParameterivATI GLEW_GET_FUN(__glewGetTexBumpParameterivATI)
+#define glTexBumpParameterfvATI GLEW_GET_FUN(__glewTexBumpParameterfvATI)
+#define glTexBumpParameterivATI GLEW_GET_FUN(__glewTexBumpParameterivATI)
+
+#define GLEW_ATI_envmap_bumpmap GLEW_GET_VAR(__GLEW_ATI_envmap_bumpmap)
+
+#endif /* GL_ATI_envmap_bumpmap */
+
+/* ------------------------- GL_ATI_fragment_shader ------------------------ */
+
+#ifndef GL_ATI_fragment_shader
+#define GL_ATI_fragment_shader 1
+
+#define GL_RED_BIT_ATI 0x00000001
+#define GL_2X_BIT_ATI 0x00000001
+#define GL_4X_BIT_ATI 0x00000002
+#define GL_GREEN_BIT_ATI 0x00000002
+#define GL_COMP_BIT_ATI 0x00000002
+#define GL_BLUE_BIT_ATI 0x00000004
+#define GL_8X_BIT_ATI 0x00000004
+#define GL_NEGATE_BIT_ATI 0x00000004
+#define GL_BIAS_BIT_ATI 0x00000008
+#define GL_HALF_BIT_ATI 0x00000008
+#define GL_QUARTER_BIT_ATI 0x00000010
+#define GL_EIGHTH_BIT_ATI 0x00000020
+#define GL_SATURATE_BIT_ATI 0x00000040
+#define GL_FRAGMENT_SHADER_ATI 0x8920
+#define GL_REG_0_ATI 0x8921
+#define GL_REG_1_ATI 0x8922
+#define GL_REG_2_ATI 0x8923
+#define GL_REG_3_ATI 0x8924
+#define GL_REG_4_ATI 0x8925
+#define GL_REG_5_ATI 0x8926
+#define GL_CON_0_ATI 0x8941
+#define GL_CON_1_ATI 0x8942
+#define GL_CON_2_ATI 0x8943
+#define GL_CON_3_ATI 0x8944
+#define GL_CON_4_ATI 0x8945
+#define GL_CON_5_ATI 0x8946
+#define GL_CON_6_ATI 0x8947
+#define GL_CON_7_ATI 0x8948
+#define GL_MOV_ATI 0x8961
+#define GL_ADD_ATI 0x8963
+#define GL_MUL_ATI 0x8964
+#define GL_SUB_ATI 0x8965
+#define GL_DOT3_ATI 0x8966
+#define GL_DOT4_ATI 0x8967
+#define GL_MAD_ATI 0x8968
+#define GL_LERP_ATI 0x8969
+#define GL_CND_ATI 0x896A
+#define GL_CND0_ATI 0x896B
+#define GL_DOT2_ADD_ATI 0x896C
+#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D
+#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E
+#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F
+#define GL_NUM_PASSES_ATI 0x8970
+#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971
+#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972
+#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973
+#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974
+#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975
+#define GL_SWIZZLE_STR_ATI 0x8976
+#define GL_SWIZZLE_STQ_ATI 0x8977
+#define GL_SWIZZLE_STR_DR_ATI 0x8978
+#define GL_SWIZZLE_STQ_DQ_ATI 0x8979
+#define GL_SWIZZLE_STRQ_ATI 0x897A
+#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B
+
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (GLAPIENTRY * PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (GLAPIENTRY * PFNGLBEGINFRAGMENTSHADERATIPROC) (void);
+typedef void (GLAPIENTRY * PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
+typedef void (GLAPIENTRY * PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
+typedef void (GLAPIENTRY * PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLENDFRAGMENTSHADERATIPROC) (void);
+typedef GLuint (GLAPIENTRY * PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range);
+typedef void (GLAPIENTRY * PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
+typedef void (GLAPIENTRY * PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
+typedef void (GLAPIENTRY * PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat* value);
+
+#define glAlphaFragmentOp1ATI GLEW_GET_FUN(__glewAlphaFragmentOp1ATI)
+#define glAlphaFragmentOp2ATI GLEW_GET_FUN(__glewAlphaFragmentOp2ATI)
+#define glAlphaFragmentOp3ATI GLEW_GET_FUN(__glewAlphaFragmentOp3ATI)
+#define glBeginFragmentShaderATI GLEW_GET_FUN(__glewBeginFragmentShaderATI)
+#define glBindFragmentShaderATI GLEW_GET_FUN(__glewBindFragmentShaderATI)
+#define glColorFragmentOp1ATI GLEW_GET_FUN(__glewColorFragmentOp1ATI)
+#define glColorFragmentOp2ATI GLEW_GET_FUN(__glewColorFragmentOp2ATI)
+#define glColorFragmentOp3ATI GLEW_GET_FUN(__glewColorFragmentOp3ATI)
+#define glDeleteFragmentShaderATI GLEW_GET_FUN(__glewDeleteFragmentShaderATI)
+#define glEndFragmentShaderATI GLEW_GET_FUN(__glewEndFragmentShaderATI)
+#define glGenFragmentShadersATI GLEW_GET_FUN(__glewGenFragmentShadersATI)
+#define glPassTexCoordATI GLEW_GET_FUN(__glewPassTexCoordATI)
+#define glSampleMapATI GLEW_GET_FUN(__glewSampleMapATI)
+#define glSetFragmentShaderConstantATI GLEW_GET_FUN(__glewSetFragmentShaderConstantATI)
+
+#define GLEW_ATI_fragment_shader GLEW_GET_VAR(__GLEW_ATI_fragment_shader)
+
+#endif /* GL_ATI_fragment_shader */
+
+/* ------------------------ GL_ATI_map_object_buffer ----------------------- */
+
+#ifndef GL_ATI_map_object_buffer
+#define GL_ATI_map_object_buffer 1
+
+typedef void* (GLAPIENTRY * PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer);
+
+#define glMapObjectBufferATI GLEW_GET_FUN(__glewMapObjectBufferATI)
+#define glUnmapObjectBufferATI GLEW_GET_FUN(__glewUnmapObjectBufferATI)
+
+#define GLEW_ATI_map_object_buffer GLEW_GET_VAR(__GLEW_ATI_map_object_buffer)
+
+#endif /* GL_ATI_map_object_buffer */
+
+/* -------------------------- GL_ATI_pn_triangles -------------------------- */
+
+#ifndef GL_ATI_pn_triangles
+#define GL_ATI_pn_triangles 1
+
+#define GL_PN_TRIANGLES_ATI 0x87F0
+#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1
+#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2
+#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3
+#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4
+#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5
+#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6
+#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7
+#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8
+
+typedef void (GLAPIENTRY * PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
+
+#define glPNTrianglesfATI GLEW_GET_FUN(__glPNTrianglewesfATI)
+#define glPNTrianglesiATI GLEW_GET_FUN(__glPNTrianglewesiATI)
+
+#define GLEW_ATI_pn_triangles GLEW_GET_VAR(__GLEW_ATI_pn_triangles)
+
+#endif /* GL_ATI_pn_triangles */
+
+/* ------------------------ GL_ATI_separate_stencil ------------------------ */
+
+#ifndef GL_ATI_separate_stencil
+#define GL_ATI_separate_stencil 1
+
+#define GL_STENCIL_BACK_FUNC_ATI 0x8800
+#define GL_STENCIL_BACK_FAIL_ATI 0x8801
+#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802
+#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803
+
+typedef void (GLAPIENTRY * PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
+typedef void (GLAPIENTRY * PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
+
+#define glStencilFuncSeparateATI GLEW_GET_FUN(__glewStencilFuncSeparateATI)
+#define glStencilOpSeparateATI GLEW_GET_FUN(__glewStencilOpSeparateATI)
+
+#define GLEW_ATI_separate_stencil GLEW_GET_VAR(__GLEW_ATI_separate_stencil)
+
+#endif /* GL_ATI_separate_stencil */
+
+/* ---------------------- GL_ATI_text_fragment_shader ---------------------- */
+
+#ifndef GL_ATI_text_fragment_shader
+#define GL_ATI_text_fragment_shader 1
+
+#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200
+
+#define GLEW_ATI_text_fragment_shader GLEW_GET_VAR(__GLEW_ATI_text_fragment_shader)
+
+#endif /* GL_ATI_text_fragment_shader */
+
+/* --------------------- GL_ATI_texture_compression_3dc -------------------- */
+
+#ifndef GL_ATI_texture_compression_3dc
+#define GL_ATI_texture_compression_3dc 1
+
+#define GL_COMPRESSED_RGB_3DC_ATI 0x8837
+
+#define GLEW_ATI_texture_compression_3dc GLEW_GET_VAR(__GLEW_ATI_texture_compression_3dc)
+
+#endif /* GL_ATI_texture_compression_3dc */
+
+/* ---------------------- GL_ATI_texture_env_combine3 ---------------------- */
+
+#ifndef GL_ATI_texture_env_combine3
+#define GL_ATI_texture_env_combine3 1
+
+#define GL_MODULATE_ADD_ATI 0x8744
+#define GL_MODULATE_SIGNED_ADD_ATI 0x8745
+#define GL_MODULATE_SUBTRACT_ATI 0x8746
+
+#define GLEW_ATI_texture_env_combine3 GLEW_GET_VAR(__GLEW_ATI_texture_env_combine3)
+
+#endif /* GL_ATI_texture_env_combine3 */
+
+/* -------------------------- GL_ATI_texture_float ------------------------- */
+
+#ifndef GL_ATI_texture_float
+#define GL_ATI_texture_float 1
+
+#define GL_RGBA_FLOAT32_ATI 0x8814
+#define GL_RGB_FLOAT32_ATI 0x8815
+#define GL_ALPHA_FLOAT32_ATI 0x8816
+#define GL_INTENSITY_FLOAT32_ATI 0x8817
+#define GL_LUMINANCE_FLOAT32_ATI 0x8818
+#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819
+#define GL_RGBA_FLOAT16_ATI 0x881A
+#define GL_RGB_FLOAT16_ATI 0x881B
+#define GL_ALPHA_FLOAT16_ATI 0x881C
+#define GL_INTENSITY_FLOAT16_ATI 0x881D
+#define GL_LUMINANCE_FLOAT16_ATI 0x881E
+#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F
+
+#define GLEW_ATI_texture_float GLEW_GET_VAR(__GLEW_ATI_texture_float)
+
+#endif /* GL_ATI_texture_float */
+
+/* ----------------------- GL_ATI_texture_mirror_once ---------------------- */
+
+#ifndef GL_ATI_texture_mirror_once
+#define GL_ATI_texture_mirror_once 1
+
+#define GL_MIRROR_CLAMP_ATI 0x8742
+#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743
+
+#define GLEW_ATI_texture_mirror_once GLEW_GET_VAR(__GLEW_ATI_texture_mirror_once)
+
+#endif /* GL_ATI_texture_mirror_once */
+
+/* ----------------------- GL_ATI_vertex_array_object ---------------------- */
+
+#ifndef GL_ATI_vertex_array_object
+#define GL_ATI_vertex_array_object 1
+
+#define GL_STATIC_ATI 0x8760
+#define GL_DYNAMIC_ATI 0x8761
+#define GL_PRESERVE_ATI 0x8762
+#define GL_DISCARD_ATI 0x8763
+#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764
+#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765
+#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766
+#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767
+
+typedef void (GLAPIENTRY * PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+typedef void (GLAPIENTRY * PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef void (GLAPIENTRY * PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer);
+typedef GLuint (GLAPIENTRY * PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const void* pointer, GLenum usage);
+typedef void (GLAPIENTRY * PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const void* pointer, GLenum preserve);
+typedef void (GLAPIENTRY * PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
+
+#define glArrayObjectATI GLEW_GET_FUN(__glewArrayObjectATI)
+#define glFreeObjectBufferATI GLEW_GET_FUN(__glewFreeObjectBufferATI)
+#define glGetArrayObjectfvATI GLEW_GET_FUN(__glewGetArrayObjectfvATI)
+#define glGetArrayObjectivATI GLEW_GET_FUN(__glewGetArrayObjectivATI)
+#define glGetObjectBufferfvATI GLEW_GET_FUN(__glewGetObjectBufferfvATI)
+#define glGetObjectBufferivATI GLEW_GET_FUN(__glewGetObjectBufferivATI)
+#define glGetVariantArrayObjectfvATI GLEW_GET_FUN(__glewGetVariantArrayObjectfvATI)
+#define glGetVariantArrayObjectivATI GLEW_GET_FUN(__glewGetVariantArrayObjectivATI)
+#define glIsObjectBufferATI GLEW_GET_FUN(__glewIsObjectBufferATI)
+#define glNewObjectBufferATI GLEW_GET_FUN(__glewNewObjectBufferATI)
+#define glUpdateObjectBufferATI GLEW_GET_FUN(__glewUpdateObjectBufferATI)
+#define glVariantArrayObjectATI GLEW_GET_FUN(__glewVariantArrayObjectATI)
+
+#define GLEW_ATI_vertex_array_object GLEW_GET_VAR(__GLEW_ATI_vertex_array_object)
+
+#endif /* GL_ATI_vertex_array_object */
+
+/* ------------------- GL_ATI_vertex_attrib_array_object ------------------- */
+
+#ifndef GL_ATI_vertex_attrib_array_object
+#define GL_ATI_vertex_attrib_array_object 1
+
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
+
+#define glGetVertexAttribArrayObjectfvATI GLEW_GET_FUN(__glewGetVertexAttribArrayObjectfvATI)
+#define glGetVertexAttribArrayObjectivATI GLEW_GET_FUN(__glewGetVertexAttribArrayObjectivATI)
+#define glVertexAttribArrayObjectATI GLEW_GET_FUN(__glewVertexAttribArrayObjectATI)
+
+#define GLEW_ATI_vertex_attrib_array_object GLEW_GET_VAR(__GLEW_ATI_vertex_attrib_array_object)
+
+#endif /* GL_ATI_vertex_attrib_array_object */
+
+/* ------------------------- GL_ATI_vertex_streams ------------------------- */
+
+#ifndef GL_ATI_vertex_streams
+#define GL_ATI_vertex_streams 1
+
+#define GL_MAX_VERTEX_STREAMS_ATI 0x876B
+#define GL_VERTEX_SOURCE_ATI 0x876C
+#define GL_VERTEX_STREAM0_ATI 0x876D
+#define GL_VERTEX_STREAM1_ATI 0x876E
+#define GL_VERTEX_STREAM2_ATI 0x876F
+#define GL_VERTEX_STREAM3_ATI 0x8770
+#define GL_VERTEX_STREAM4_ATI 0x8771
+#define GL_VERTEX_STREAM5_ATI 0x8772
+#define GL_VERTEX_STREAM6_ATI 0x8773
+#define GL_VERTEX_STREAM7_ATI 0x8774
+
+typedef void (GLAPIENTRY * PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte x, GLbyte y, GLbyte z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *v);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *v);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *v);
+
+#define glClientActiveVertexStreamATI GLEW_GET_FUN(__glewClientActiveVertexStreamATI)
+#define glNormalStream3bATI GLEW_GET_FUN(__glewNormalStream3bATI)
+#define glNormalStream3bvATI GLEW_GET_FUN(__glewNormalStream3bvATI)
+#define glNormalStream3dATI GLEW_GET_FUN(__glewNormalStream3dATI)
+#define glNormalStream3dvATI GLEW_GET_FUN(__glewNormalStream3dvATI)
+#define glNormalStream3fATI GLEW_GET_FUN(__glewNormalStream3fATI)
+#define glNormalStream3fvATI GLEW_GET_FUN(__glewNormalStream3fvATI)
+#define glNormalStream3iATI GLEW_GET_FUN(__glewNormalStream3iATI)
+#define glNormalStream3ivATI GLEW_GET_FUN(__glewNormalStream3ivATI)
+#define glNormalStream3sATI GLEW_GET_FUN(__glewNormalStream3sATI)
+#define glNormalStream3svATI GLEW_GET_FUN(__glewNormalStream3svATI)
+#define glVertexBlendEnvfATI GLEW_GET_FUN(__glewVertexBlendEnvfATI)
+#define glVertexBlendEnviATI GLEW_GET_FUN(__glewVertexBlendEnviATI)
+#define glVertexStream2dATI GLEW_GET_FUN(__glewVertexStream2dATI)
+#define glVertexStream2dvATI GLEW_GET_FUN(__glewVertexStream2dvATI)
+#define glVertexStream2fATI GLEW_GET_FUN(__glewVertexStream2fATI)
+#define glVertexStream2fvATI GLEW_GET_FUN(__glewVertexStream2fvATI)
+#define glVertexStream2iATI GLEW_GET_FUN(__glewVertexStream2iATI)
+#define glVertexStream2ivATI GLEW_GET_FUN(__glewVertexStream2ivATI)
+#define glVertexStream2sATI GLEW_GET_FUN(__glewVertexStream2sATI)
+#define glVertexStream2svATI GLEW_GET_FUN(__glewVertexStream2svATI)
+#define glVertexStream3dATI GLEW_GET_FUN(__glewVertexStream3dATI)
+#define glVertexStream3dvATI GLEW_GET_FUN(__glewVertexStream3dvATI)
+#define glVertexStream3fATI GLEW_GET_FUN(__glewVertexStream3fATI)
+#define glVertexStream3fvATI GLEW_GET_FUN(__glewVertexStream3fvATI)
+#define glVertexStream3iATI GLEW_GET_FUN(__glewVertexStream3iATI)
+#define glVertexStream3ivATI GLEW_GET_FUN(__glewVertexStream3ivATI)
+#define glVertexStream3sATI GLEW_GET_FUN(__glewVertexStream3sATI)
+#define glVertexStream3svATI GLEW_GET_FUN(__glewVertexStream3svATI)
+#define glVertexStream4dATI GLEW_GET_FUN(__glewVertexStream4dATI)
+#define glVertexStream4dvATI GLEW_GET_FUN(__glewVertexStream4dvATI)
+#define glVertexStream4fATI GLEW_GET_FUN(__glewVertexStream4fATI)
+#define glVertexStream4fvATI GLEW_GET_FUN(__glewVertexStream4fvATI)
+#define glVertexStream4iATI GLEW_GET_FUN(__glewVertexStream4iATI)
+#define glVertexStream4ivATI GLEW_GET_FUN(__glewVertexStream4ivATI)
+#define glVertexStream4sATI GLEW_GET_FUN(__glewVertexStream4sATI)
+#define glVertexStream4svATI GLEW_GET_FUN(__glewVertexStream4svATI)
+
+#define GLEW_ATI_vertex_streams GLEW_GET_VAR(__GLEW_ATI_vertex_streams)
+
+#endif /* GL_ATI_vertex_streams */
+
+/* --------------------------- GL_EXT_422_pixels --------------------------- */
+
+#ifndef GL_EXT_422_pixels
+#define GL_EXT_422_pixels 1
+
+#define GL_422_EXT 0x80CC
+#define GL_422_REV_EXT 0x80CD
+#define GL_422_AVERAGE_EXT 0x80CE
+#define GL_422_REV_AVERAGE_EXT 0x80CF
+
+#define GLEW_EXT_422_pixels GLEW_GET_VAR(__GLEW_EXT_422_pixels)
+
+#endif /* GL_EXT_422_pixels */
+
+/* ---------------------------- GL_EXT_Cg_shader --------------------------- */
+
+#ifndef GL_EXT_Cg_shader
+#define GL_EXT_Cg_shader 1
+
+#define GL_CG_VERTEX_SHADER_EXT 0x890E
+#define GL_CG_FRAGMENT_SHADER_EXT 0x890F
+
+#define GLEW_EXT_Cg_shader GLEW_GET_VAR(__GLEW_EXT_Cg_shader)
+
+#endif /* GL_EXT_Cg_shader */
+
+/* ------------------------------ GL_EXT_abgr ------------------------------ */
+
+#ifndef GL_EXT_abgr
+#define GL_EXT_abgr 1
+
+#define GL_ABGR_EXT 0x8000
+
+#define GLEW_EXT_abgr GLEW_GET_VAR(__GLEW_EXT_abgr)
+
+#endif /* GL_EXT_abgr */
+
+/* ------------------------------ GL_EXT_bgra ------------------------------ */
+
+#ifndef GL_EXT_bgra
+#define GL_EXT_bgra 1
+
+#define GL_BGR_EXT 0x80E0
+#define GL_BGRA_EXT 0x80E1
+
+#define GLEW_EXT_bgra GLEW_GET_VAR(__GLEW_EXT_bgra)
+
+#endif /* GL_EXT_bgra */
+
+/* --------------------------- GL_EXT_blend_color -------------------------- */
+
+#ifndef GL_EXT_blend_color
+#define GL_EXT_blend_color 1
+
+#define GL_CONSTANT_COLOR_EXT 0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002
+#define GL_CONSTANT_ALPHA_EXT 0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004
+#define GL_BLEND_COLOR_EXT 0x8005
+
+typedef void (GLAPIENTRY * PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+
+#define glBlendColorEXT GLEW_GET_FUN(__glewBlendColorEXT)
+
+#define GLEW_EXT_blend_color GLEW_GET_VAR(__GLEW_EXT_blend_color)
+
+#endif /* GL_EXT_blend_color */
+
+/* --------------------- GL_EXT_blend_equation_separate -------------------- */
+
+#ifndef GL_EXT_blend_equation_separate
+#define GL_EXT_blend_equation_separate 1
+
+#define GL_BLEND_EQUATION_RGB_EXT 0x8009
+#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D
+
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha);
+
+#define glBlendEquationSeparateEXT GLEW_GET_FUN(__glewBlendEquationSeparateEXT)
+
+#define GLEW_EXT_blend_equation_separate GLEW_GET_VAR(__GLEW_EXT_blend_equation_separate)
+
+#endif /* GL_EXT_blend_equation_separate */
+
+/* ----------------------- GL_EXT_blend_func_separate ---------------------- */
+
+#ifndef GL_EXT_blend_func_separate
+#define GL_EXT_blend_func_separate 1
+
+#define GL_BLEND_DST_RGB_EXT 0x80C8
+#define GL_BLEND_SRC_RGB_EXT 0x80C9
+#define GL_BLEND_DST_ALPHA_EXT 0x80CA
+#define GL_BLEND_SRC_ALPHA_EXT 0x80CB
+
+typedef void (GLAPIENTRY * PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+
+#define glBlendFuncSeparateEXT GLEW_GET_FUN(__glewBlendFuncSeparateEXT)
+
+#define GLEW_EXT_blend_func_separate GLEW_GET_VAR(__GLEW_EXT_blend_func_separate)
+
+#endif /* GL_EXT_blend_func_separate */
+
+/* ------------------------- GL_EXT_blend_logic_op ------------------------- */
+
+#ifndef GL_EXT_blend_logic_op
+#define GL_EXT_blend_logic_op 1
+
+#define GLEW_EXT_blend_logic_op GLEW_GET_VAR(__GLEW_EXT_blend_logic_op)
+
+#endif /* GL_EXT_blend_logic_op */
+
+/* -------------------------- GL_EXT_blend_minmax -------------------------- */
+
+#ifndef GL_EXT_blend_minmax
+#define GL_EXT_blend_minmax 1
+
+#define GL_FUNC_ADD_EXT 0x8006
+#define GL_MIN_EXT 0x8007
+#define GL_MAX_EXT 0x8008
+#define GL_BLEND_EQUATION_EXT 0x8009
+
+typedef void (GLAPIENTRY * PFNGLBLENDEQUATIONEXTPROC) (GLenum mode);
+
+#define glBlendEquationEXT GLEW_GET_FUN(__glewBlendEquationEXT)
+
+#define GLEW_EXT_blend_minmax GLEW_GET_VAR(__GLEW_EXT_blend_minmax)
+
+#endif /* GL_EXT_blend_minmax */
+
+/* ------------------------- GL_EXT_blend_subtract ------------------------- */
+
+#ifndef GL_EXT_blend_subtract
+#define GL_EXT_blend_subtract 1
+
+#define GL_FUNC_SUBTRACT_EXT 0x800A
+#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B
+
+#define GLEW_EXT_blend_subtract GLEW_GET_VAR(__GLEW_EXT_blend_subtract)
+
+#endif /* GL_EXT_blend_subtract */
+
+/* ------------------------ GL_EXT_clip_volume_hint ------------------------ */
+
+#ifndef GL_EXT_clip_volume_hint
+#define GL_EXT_clip_volume_hint 1
+
+#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0
+
+#define GLEW_EXT_clip_volume_hint GLEW_GET_VAR(__GLEW_EXT_clip_volume_hint)
+
+#endif /* GL_EXT_clip_volume_hint */
+
+/* ------------------------------ GL_EXT_cmyka ----------------------------- */
+
+#ifndef GL_EXT_cmyka
+#define GL_EXT_cmyka 1
+
+#define GL_CMYK_EXT 0x800C
+#define GL_CMYKA_EXT 0x800D
+#define GL_PACK_CMYK_HINT_EXT 0x800E
+#define GL_UNPACK_CMYK_HINT_EXT 0x800F
+
+#define GLEW_EXT_cmyka GLEW_GET_VAR(__GLEW_EXT_cmyka)
+
+#endif /* GL_EXT_cmyka */
+
+/* ------------------------- GL_EXT_color_subtable ------------------------- */
+
+#ifndef GL_EXT_color_subtable
+#define GL_EXT_color_subtable 1
+
+typedef void (GLAPIENTRY * PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const void* data);
+typedef void (GLAPIENTRY * PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+
+#define glColorSubTableEXT GLEW_GET_FUN(__glewColorSubTableEXT)
+#define glCopyColorSubTableEXT GLEW_GET_FUN(__glewCopyColorSubTableEXT)
+
+#define GLEW_EXT_color_subtable GLEW_GET_VAR(__GLEW_EXT_color_subtable)
+
+#endif /* GL_EXT_color_subtable */
+
+/* ---------------------- GL_EXT_compiled_vertex_array --------------------- */
+
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_EXT_compiled_vertex_array 1
+
+typedef void (GLAPIENTRY * PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLUNLOCKARRAYSEXTPROC) (void);
+
+#define glLockArraysEXT GLEW_GET_FUN(__glewLockArraysEXT)
+#define glUnlockArraysEXT GLEW_GET_FUN(__glewUnlockArraysEXT)
+
+#define GLEW_EXT_compiled_vertex_array GLEW_GET_VAR(__GLEW_EXT_compiled_vertex_array)
+
+#endif /* GL_EXT_compiled_vertex_array */
+
+/* --------------------------- GL_EXT_convolution -------------------------- */
+
+#ifndef GL_EXT_convolution
+#define GL_EXT_convolution 1
+
+#define GL_CONVOLUTION_1D_EXT 0x8010
+#define GL_CONVOLUTION_2D_EXT 0x8011
+#define GL_SEPARABLE_2D_EXT 0x8012
+#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013
+#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014
+#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015
+#define GL_REDUCE_EXT 0x8016
+#define GL_CONVOLUTION_FORMAT_EXT 0x8017
+#define GL_CONVOLUTION_WIDTH_EXT 0x8018
+#define GL_CONVOLUTION_HEIGHT_EXT 0x8019
+#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023
+
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const void* image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void* image);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void* image);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, void* row, void* column, void* span);
+typedef void (GLAPIENTRY * PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const void* row, const void* column);
+
+#define glConvolutionFilter1DEXT GLEW_GET_FUN(__glewConvolutionFilter1DEXT)
+#define glConvolutionFilter2DEXT GLEW_GET_FUN(__glewConvolutionFilter2DEXT)
+#define glConvolutionParameterfEXT GLEW_GET_FUN(__glewConvolutionParameterfEXT)
+#define glConvolutionParameterfvEXT GLEW_GET_FUN(__glewConvolutionParameterfvEXT)
+#define glConvolutionParameteriEXT GLEW_GET_FUN(__glewConvolutionParameteriEXT)
+#define glConvolutionParameterivEXT GLEW_GET_FUN(__glewConvolutionParameterivEXT)
+#define glCopyConvolutionFilter1DEXT GLEW_GET_FUN(__glewCopyConvolutionFilter1DEXT)
+#define glCopyConvolutionFilter2DEXT GLEW_GET_FUN(__glewCopyConvolutionFilter2DEXT)
+#define glGetConvolutionFilterEXT GLEW_GET_FUN(__glewGetConvolutionFilterEXT)
+#define glGetConvolutionParameterfvEXT GLEW_GET_FUN(__glewGetConvolutionParameterfvEXT)
+#define glGetConvolutionParameterivEXT GLEW_GET_FUN(__glewGetConvolutionParameterivEXT)
+#define glGetSeparableFilterEXT GLEW_GET_FUN(__glewGetSeparableFilterEXT)
+#define glSeparableFilter2DEXT GLEW_GET_FUN(__glewSeparableFilter2DEXT)
+
+#define GLEW_EXT_convolution GLEW_GET_VAR(__GLEW_EXT_convolution)
+
+#endif /* GL_EXT_convolution */
+
+/* ------------------------ GL_EXT_coordinate_frame ------------------------ */
+
+#ifndef GL_EXT_coordinate_frame
+#define GL_EXT_coordinate_frame 1
+
+#define GL_TANGENT_ARRAY_EXT 0x8439
+#define GL_BINORMAL_ARRAY_EXT 0x843A
+#define GL_CURRENT_TANGENT_EXT 0x843B
+#define GL_CURRENT_BINORMAL_EXT 0x843C
+#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E
+#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F
+#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440
+#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441
+#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442
+#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443
+#define GL_MAP1_TANGENT_EXT 0x8444
+#define GL_MAP2_TANGENT_EXT 0x8445
+#define GL_MAP1_BINORMAL_EXT 0x8446
+#define GL_MAP2_BINORMAL_EXT 0x8447
+
+typedef void (GLAPIENTRY * PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, void* pointer);
+typedef void (GLAPIENTRY * PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, void* pointer);
+
+#define glBinormalPointerEXT GLEW_GET_FUN(__glewBinormalPointerEXT)
+#define glTangentPointerEXT GLEW_GET_FUN(__glewTangentPointerEXT)
+
+#define GLEW_EXT_coordinate_frame GLEW_GET_VAR(__GLEW_EXT_coordinate_frame)
+
+#endif /* GL_EXT_coordinate_frame */
+
+/* -------------------------- GL_EXT_copy_texture -------------------------- */
+
+#ifndef GL_EXT_copy_texture
+#define GL_EXT_copy_texture 1
+
+typedef void (GLAPIENTRY * PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (GLAPIENTRY * PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+
+#define glCopyTexImage1DEXT GLEW_GET_FUN(__glewCopyTexImage1DEXT)
+#define glCopyTexImage2DEXT GLEW_GET_FUN(__glewCopyTexImage2DEXT)
+#define glCopyTexSubImage1DEXT GLEW_GET_FUN(__glewCopyTexSubImage1DEXT)
+#define glCopyTexSubImage2DEXT GLEW_GET_FUN(__glewCopyTexSubImage2DEXT)
+#define glCopyTexSubImage3DEXT GLEW_GET_FUN(__glewCopyTexSubImage3DEXT)
+
+#define GLEW_EXT_copy_texture GLEW_GET_VAR(__GLEW_EXT_copy_texture)
+
+#endif /* GL_EXT_copy_texture */
+
+/* --------------------------- GL_EXT_cull_vertex -------------------------- */
+
+#ifndef GL_EXT_cull_vertex
+#define GL_EXT_cull_vertex 1
+
+typedef void (GLAPIENTRY * PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat* params);
+
+#define glCullParameterdvEXT GLEW_GET_FUN(__glewCullParameterdvEXT)
+#define glCullParameterfvEXT GLEW_GET_FUN(__glewCullParameterfvEXT)
+
+#define GLEW_EXT_cull_vertex GLEW_GET_VAR(__GLEW_EXT_cull_vertex)
+
+#endif /* GL_EXT_cull_vertex */
+
+/* ------------------------ GL_EXT_depth_bounds_test ----------------------- */
+
+#ifndef GL_EXT_depth_bounds_test
+#define GL_EXT_depth_bounds_test 1
+
+#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890
+#define GL_DEPTH_BOUNDS_EXT 0x8891
+
+typedef void (GLAPIENTRY * PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
+
+#define glDepthBoundsEXT GLEW_GET_FUN(__glewDepthBoundsEXT)
+
+#define GLEW_EXT_depth_bounds_test GLEW_GET_VAR(__GLEW_EXT_depth_bounds_test)
+
+#endif /* GL_EXT_depth_bounds_test */
+
+/* ----------------------- GL_EXT_draw_range_elements ---------------------- */
+
+#ifndef GL_EXT_draw_range_elements
+#define GL_EXT_draw_range_elements 1
+
+#define GL_MAX_ELEMENTS_VERTICES 0x80E8
+#define GL_MAX_ELEMENTS_INDICES 0x80E9
+
+typedef void (GLAPIENTRY * PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
+
+#define glDrawRangeElementsEXT GLEW_GET_FUN(__glewDrawRangeElementsEXT)
+
+#define GLEW_EXT_draw_range_elements GLEW_GET_VAR(__GLEW_EXT_draw_range_elements)
+
+#endif /* GL_EXT_draw_range_elements */
+
+/* ---------------------------- GL_EXT_fog_coord --------------------------- */
+
+#ifndef GL_EXT_fog_coord
+#define GL_EXT_fog_coord 1
+
+#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450
+#define GL_FOG_COORDINATE_EXT 0x8451
+#define GL_FRAGMENT_DEPTH_EXT 0x8452
+#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453
+#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454
+#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455
+#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456
+#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457
+
+typedef void (GLAPIENTRY * PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDEXTPROC) (GLdouble coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFEXTPROC) (GLfloat coord);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord);
+
+#define glFogCoordPointerEXT GLEW_GET_FUN(__glewFogCoordPointerEXT)
+#define glFogCoorddEXT GLEW_GET_FUN(__glewFogCoorddEXT)
+#define glFogCoorddvEXT GLEW_GET_FUN(__glewFogCoorddvEXT)
+#define glFogCoordfEXT GLEW_GET_FUN(__glewFogCoordfEXT)
+#define glFogCoordfvEXT GLEW_GET_FUN(__glewFogCoordfvEXT)
+
+#define GLEW_EXT_fog_coord GLEW_GET_VAR(__GLEW_EXT_fog_coord)
+
+#endif /* GL_EXT_fog_coord */
+
+/* ------------------------ GL_EXT_fragment_lighting ----------------------- */
+
+#ifndef GL_EXT_fragment_lighting
+#define GL_EXT_fragment_lighting 1
+
+#define GL_FRAGMENT_LIGHTING_EXT 0x8400
+#define GL_FRAGMENT_COLOR_MATERIAL_EXT 0x8401
+#define GL_FRAGMENT_COLOR_MATERIAL_FACE_EXT 0x8402
+#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_EXT 0x8403
+#define GL_MAX_FRAGMENT_LIGHTS_EXT 0x8404
+#define GL_MAX_ACTIVE_LIGHTS_EXT 0x8405
+#define GL_CURRENT_RASTER_NORMAL_EXT 0x8406
+#define GL_LIGHT_ENV_MODE_EXT 0x8407
+#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_EXT 0x8408
+#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_EXT 0x8409
+#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_EXT 0x840A
+#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_EXT 0x840B
+#define GL_FRAGMENT_LIGHT0_EXT 0x840C
+#define GL_FRAGMENT_LIGHT7_EXT 0x8413
+
+typedef void (GLAPIENTRY * PFNGLFRAGMENTCOLORMATERIALEXTPROC) (GLenum face, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELFEXTPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELFVEXTPROC) (GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELIEXTPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELIVEXTPROC) (GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTFEXTPROC) (GLenum light, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTFVEXTPROC) (GLenum light, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTIEXTPROC) (GLenum light, GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTIVEXTPROC) (GLenum light, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALFEXTPROC) (GLenum face, GLenum pname, const GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALFVEXTPROC) (GLenum face, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALIEXTPROC) (GLenum face, GLenum pname, const GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALIVEXTPROC) (GLenum face, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTLIGHTFVEXTPROC) (GLenum light, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTLIGHTIVEXTPROC) (GLenum light, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTMATERIALFVEXTPROC) (GLenum face, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTMATERIALIVEXTPROC) (GLenum face, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLLIGHTENVIEXTPROC) (GLenum pname, GLint param);
+
+#define glFragmentColorMaterialEXT GLEW_GET_FUN(__glewFragmentColorMaterialEXT)
+#define glFragmentLightModelfEXT GLEW_GET_FUN(__glewFragmentLightModelfEXT)
+#define glFragmentLightModelfvEXT GLEW_GET_FUN(__glewFragmentLightModelfvEXT)
+#define glFragmentLightModeliEXT GLEW_GET_FUN(__glewFragmentLightModeliEXT)
+#define glFragmentLightModelivEXT GLEW_GET_FUN(__glewFragmentLightModelivEXT)
+#define glFragmentLightfEXT GLEW_GET_FUN(__glewFragmentLightfEXT)
+#define glFragmentLightfvEXT GLEW_GET_FUN(__glewFragmentLightfvEXT)
+#define glFragmentLightiEXT GLEW_GET_FUN(__glewFragmentLightiEXT)
+#define glFragmentLightivEXT GLEW_GET_FUN(__glewFragmentLightivEXT)
+#define glFragmentMaterialfEXT GLEW_GET_FUN(__glewFragmentMaterialfEXT)
+#define glFragmentMaterialfvEXT GLEW_GET_FUN(__glewFragmentMaterialfvEXT)
+#define glFragmentMaterialiEXT GLEW_GET_FUN(__glewFragmentMaterialiEXT)
+#define glFragmentMaterialivEXT GLEW_GET_FUN(__glewFragmentMaterialivEXT)
+#define glGetFragmentLightfvEXT GLEW_GET_FUN(__glewGetFragmentLightfvEXT)
+#define glGetFragmentLightivEXT GLEW_GET_FUN(__glewGetFragmentLightivEXT)
+#define glGetFragmentMaterialfvEXT GLEW_GET_FUN(__glewGetFragmentMaterialfvEXT)
+#define glGetFragmentMaterialivEXT GLEW_GET_FUN(__glewGetFragmentMaterialivEXT)
+#define glLightEnviEXT GLEW_GET_FUN(__glewLightEnviEXT)
+
+#define GLEW_EXT_fragment_lighting GLEW_GET_VAR(__GLEW_EXT_fragment_lighting)
+
+#endif /* GL_EXT_fragment_lighting */
+
+/* ------------------------ GL_EXT_framebuffer_blit ------------------------ */
+
+#ifndef GL_EXT_framebuffer_blit
+#define GL_EXT_framebuffer_blit 1
+
+#define GL_DRAW_FRAMEBUFFER_BINDING_EXT 0x8CA6
+#define GL_READ_FRAMEBUFFER_EXT 0x8CA8
+#define GL_DRAW_FRAMEBUFFER_EXT 0x8CA9
+#define GL_READ_FRAMEBUFFER_BINDING_EXT 0x8CAA
+
+typedef void (GLAPIENTRY * PFNGLBLITFRAMEBUFFEREXTPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter);
+
+#define glBlitFramebufferEXT GLEW_GET_FUN(__glewBlitFramebufferEXT)
+
+#define GLEW_EXT_framebuffer_blit GLEW_GET_VAR(__GLEW_EXT_framebuffer_blit)
+
+#endif /* GL_EXT_framebuffer_blit */
+
+/* --------------------- GL_EXT_framebuffer_multisample -------------------- */
+
+#ifndef GL_EXT_framebuffer_multisample
+#define GL_EXT_framebuffer_multisample 1
+
+#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB
+
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height);
+
+#define glRenderbufferStorageMultisampleEXT GLEW_GET_FUN(__glewRenderbufferStorageMultisampleEXT)
+
+#define GLEW_EXT_framebuffer_multisample GLEW_GET_VAR(__GLEW_EXT_framebuffer_multisample)
+
+#endif /* GL_EXT_framebuffer_multisample */
+
+/* ----------------------- GL_EXT_framebuffer_object ----------------------- */
+
+#ifndef GL_EXT_framebuffer_object
+#define GL_EXT_framebuffer_object 1
+
+#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506
+#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8
+#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6
+#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7
+#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0
+#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3
+#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4
+#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5
+#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6
+#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7
+#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9
+#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA
+#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB
+#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC
+#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD
+#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF
+#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0
+#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1
+#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2
+#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3
+#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4
+#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5
+#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6
+#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7
+#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8
+#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9
+#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA
+#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB
+#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC
+#define GL_COLOR_ATTACHMENT13_EXT 0x8CED
+#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE
+#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF
+#define GL_DEPTH_ATTACHMENT_EXT 0x8D00
+#define GL_STENCIL_ATTACHMENT_EXT 0x8D20
+#define GL_FRAMEBUFFER_EXT 0x8D40
+#define GL_RENDERBUFFER_EXT 0x8D41
+#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42
+#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43
+#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44
+#define GL_STENCIL_INDEX1_EXT 0x8D46
+#define GL_STENCIL_INDEX4_EXT 0x8D47
+#define GL_STENCIL_INDEX8_EXT 0x8D48
+#define GL_STENCIL_INDEX16_EXT 0x8D49
+#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50
+#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51
+#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52
+#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53
+#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54
+#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55
+
+typedef void (GLAPIENTRY * PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer);
+typedef void (GLAPIENTRY * PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer);
+typedef GLenum (GLAPIENTRY * PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
+typedef void (GLAPIENTRY * PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
+typedef void (GLAPIENTRY * PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint* framebuffers);
+typedef void (GLAPIENTRY * PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint* renderbuffers);
+typedef void (GLAPIENTRY * PFNGLGENERATEMIPMAPEXTPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer);
+typedef GLboolean (GLAPIENTRY * PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer);
+typedef void (GLAPIENTRY * PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
+
+#define glBindFramebufferEXT GLEW_GET_FUN(__glewBindFramebufferEXT)
+#define glBindRenderbufferEXT GLEW_GET_FUN(__glewBindRenderbufferEXT)
+#define glCheckFramebufferStatusEXT GLEW_GET_FUN(__glewCheckFramebufferStatusEXT)
+#define glDeleteFramebuffersEXT GLEW_GET_FUN(__glewDeleteFramebuffersEXT)
+#define glDeleteRenderbuffersEXT GLEW_GET_FUN(__glewDeleteRenderbuffersEXT)
+#define glFramebufferRenderbufferEXT GLEW_GET_FUN(__glewFramebufferRenderbufferEXT)
+#define glFramebufferTexture1DEXT GLEW_GET_FUN(__glewFramebufferTexture1DEXT)
+#define glFramebufferTexture2DEXT GLEW_GET_FUN(__glewFramebufferTexture2DEXT)
+#define glFramebufferTexture3DEXT GLEW_GET_FUN(__glewFramebufferTexture3DEXT)
+#define glGenFramebuffersEXT GLEW_GET_FUN(__glewGenFramebuffersEXT)
+#define glGenRenderbuffersEXT GLEW_GET_FUN(__glewGenRenderbuffersEXT)
+#define glGenerateMipmapEXT GLEW_GET_FUN(__glewGenerateMipmapEXT)
+#define glGetFramebufferAttachmentParameterivEXT GLEW_GET_FUN(__glewGetFramebufferAttachmentParameterivEXT)
+#define glGetRenderbufferParameterivEXT GLEW_GET_FUN(__glewGetRenderbufferParameterivEXT)
+#define glIsFramebufferEXT GLEW_GET_FUN(__glewIsFramebufferEXT)
+#define glIsRenderbufferEXT GLEW_GET_FUN(__glewIsRenderbufferEXT)
+#define glRenderbufferStorageEXT GLEW_GET_FUN(__glewRenderbufferStorageEXT)
+
+#define GLEW_EXT_framebuffer_object GLEW_GET_VAR(__GLEW_EXT_framebuffer_object)
+
+#endif /* GL_EXT_framebuffer_object */
+
+/* ---------------------------- GL_EXT_histogram --------------------------- */
+
+#ifndef GL_EXT_histogram
+#define GL_EXT_histogram 1
+
+#define GL_HISTOGRAM_EXT 0x8024
+#define GL_PROXY_HISTOGRAM_EXT 0x8025
+#define GL_HISTOGRAM_WIDTH_EXT 0x8026
+#define GL_HISTOGRAM_FORMAT_EXT 0x8027
+#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028
+#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029
+#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C
+#define GL_HISTOGRAM_SINK_EXT 0x802D
+#define GL_MINMAX_EXT 0x802E
+#define GL_MINMAX_FORMAT_EXT 0x802F
+#define GL_MINMAX_SINK_EXT 0x8030
+
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void* values);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, void* values);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink);
+typedef void (GLAPIENTRY * PFNGLRESETHISTOGRAMEXTPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLRESETMINMAXEXTPROC) (GLenum target);
+
+#define glGetHistogramEXT GLEW_GET_FUN(__glewGetHistogramEXT)
+#define glGetHistogramParameterfvEXT GLEW_GET_FUN(__glewGetHistogramParameterfvEXT)
+#define glGetHistogramParameterivEXT GLEW_GET_FUN(__glewGetHistogramParameterivEXT)
+#define glGetMinmaxEXT GLEW_GET_FUN(__glewGetMinmaxEXT)
+#define glGetMinmaxParameterfvEXT GLEW_GET_FUN(__glewGetMinmaxParameterfvEXT)
+#define glGetMinmaxParameterivEXT GLEW_GET_FUN(__glewGetMinmaxParameterivEXT)
+#define glHistogramEXT GLEW_GET_FUN(__glewHistogramEXT)
+#define glMinmaxEXT GLEW_GET_FUN(__glewMinmaxEXT)
+#define glResetHistogramEXT GLEW_GET_FUN(__glewResetHistogramEXT)
+#define glResetMinmaxEXT GLEW_GET_FUN(__glewResetMinmaxEXT)
+
+#define GLEW_EXT_histogram GLEW_GET_VAR(__GLEW_EXT_histogram)
+
+#endif /* GL_EXT_histogram */
+
+/* ----------------------- GL_EXT_index_array_formats ---------------------- */
+
+#ifndef GL_EXT_index_array_formats
+#define GL_EXT_index_array_formats 1
+
+#define GLEW_EXT_index_array_formats GLEW_GET_VAR(__GLEW_EXT_index_array_formats)
+
+#endif /* GL_EXT_index_array_formats */
+
+/* --------------------------- GL_EXT_index_func --------------------------- */
+
+#ifndef GL_EXT_index_func
+#define GL_EXT_index_func 1
+
+typedef void (GLAPIENTRY * PFNGLINDEXFUNCEXTPROC) (GLenum func, GLfloat ref);
+
+#define glIndexFuncEXT GLEW_GET_FUN(__glewIndexFuncEXT)
+
+#define GLEW_EXT_index_func GLEW_GET_VAR(__GLEW_EXT_index_func)
+
+#endif /* GL_EXT_index_func */
+
+/* ------------------------- GL_EXT_index_material ------------------------- */
+
+#ifndef GL_EXT_index_material
+#define GL_EXT_index_material 1
+
+typedef void (GLAPIENTRY * PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode);
+
+#define glIndexMaterialEXT GLEW_GET_FUN(__glewIndexMaterialEXT)
+
+#define GLEW_EXT_index_material GLEW_GET_VAR(__GLEW_EXT_index_material)
+
+#endif /* GL_EXT_index_material */
+
+/* -------------------------- GL_EXT_index_texture ------------------------- */
+
+#ifndef GL_EXT_index_texture
+#define GL_EXT_index_texture 1
+
+#define GLEW_EXT_index_texture GLEW_GET_VAR(__GLEW_EXT_index_texture)
+
+#endif /* GL_EXT_index_texture */
+
+/* -------------------------- GL_EXT_light_texture ------------------------- */
+
+#ifndef GL_EXT_light_texture
+#define GL_EXT_light_texture 1
+
+#define GL_FRAGMENT_MATERIAL_EXT 0x8349
+#define GL_FRAGMENT_NORMAL_EXT 0x834A
+#define GL_FRAGMENT_COLOR_EXT 0x834C
+#define GL_ATTENUATION_EXT 0x834D
+#define GL_SHADOW_ATTENUATION_EXT 0x834E
+#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F
+#define GL_TEXTURE_LIGHT_EXT 0x8350
+#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351
+#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352
+#define GL_FRAGMENT_DEPTH_EXT 0x8452
+
+typedef void (GLAPIENTRY * PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode);
+typedef void (GLAPIENTRY * PFNGLTEXTURELIGHTEXTPROC) (GLenum pname);
+typedef void (GLAPIENTRY * PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode);
+
+#define glApplyTextureEXT GLEW_GET_FUN(__glewApplyTextureEXT)
+#define glTextureLightEXT GLEW_GET_FUN(__glewTextureLightEXT)
+#define glTextureMaterialEXT GLEW_GET_FUN(__glewTextureMaterialEXT)
+
+#define GLEW_EXT_light_texture GLEW_GET_VAR(__GLEW_EXT_light_texture)
+
+#endif /* GL_EXT_light_texture */
+
+/* ------------------------- GL_EXT_misc_attribute ------------------------- */
+
+#ifndef GL_EXT_misc_attribute
+#define GL_EXT_misc_attribute 1
+
+#define GLEW_EXT_misc_attribute GLEW_GET_VAR(__GLEW_EXT_misc_attribute)
+
+#endif /* GL_EXT_misc_attribute */
+
+/* ------------------------ GL_EXT_multi_draw_arrays ----------------------- */
+
+#ifndef GL_EXT_multi_draw_arrays
+#define GL_EXT_multi_draw_arrays 1
+
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint* first, GLsizei *count, GLsizei primcount);
+typedef void (GLAPIENTRY * PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, GLsizei* count, GLenum type, const GLvoid **indices, GLsizei primcount);
+
+#define glMultiDrawArraysEXT GLEW_GET_FUN(__glewMultiDrawArraysEXT)
+#define glMultiDrawElementsEXT GLEW_GET_FUN(__glewMultiDrawElementsEXT)
+
+#define GLEW_EXT_multi_draw_arrays GLEW_GET_VAR(__GLEW_EXT_multi_draw_arrays)
+
+#endif /* GL_EXT_multi_draw_arrays */
+
+/* --------------------------- GL_EXT_multisample -------------------------- */
+
+#ifndef GL_EXT_multisample
+#define GL_EXT_multisample 1
+
+#define GL_MULTISAMPLE_EXT 0x809D
+#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F
+#define GL_SAMPLE_MASK_EXT 0x80A0
+#define GL_1PASS_EXT 0x80A1
+#define GL_2PASS_0_EXT 0x80A2
+#define GL_2PASS_1_EXT 0x80A3
+#define GL_4PASS_0_EXT 0x80A4
+#define GL_4PASS_1_EXT 0x80A5
+#define GL_4PASS_2_EXT 0x80A6
+#define GL_4PASS_3_EXT 0x80A7
+#define GL_SAMPLE_BUFFERS_EXT 0x80A8
+#define GL_SAMPLES_EXT 0x80A9
+#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA
+#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB
+#define GL_SAMPLE_PATTERN_EXT 0x80AC
+#define GL_MULTISAMPLE_BIT_EXT 0x20000000
+
+typedef void (GLAPIENTRY * PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert);
+typedef void (GLAPIENTRY * PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern);
+
+#define glSampleMaskEXT GLEW_GET_FUN(__glewSampleMaskEXT)
+#define glSamplePatternEXT GLEW_GET_FUN(__glewSamplePatternEXT)
+
+#define GLEW_EXT_multisample GLEW_GET_VAR(__GLEW_EXT_multisample)
+
+#endif /* GL_EXT_multisample */
+
+/* ---------------------- GL_EXT_packed_depth_stencil ---------------------- */
+
+#ifndef GL_EXT_packed_depth_stencil
+#define GL_EXT_packed_depth_stencil 1
+
+#define GL_DEPTH_STENCIL_EXT 0x84F9
+#define GL_UNSIGNED_INT_24_8_EXT 0x84FA
+#define GL_DEPTH24_STENCIL8_EXT 0x88F0
+#define GL_TEXTURE_STENCIL_SIZE_EXT 0x88F1
+
+#define GLEW_EXT_packed_depth_stencil GLEW_GET_VAR(__GLEW_EXT_packed_depth_stencil)
+
+#endif /* GL_EXT_packed_depth_stencil */
+
+/* -------------------------- GL_EXT_packed_pixels ------------------------- */
+
+#ifndef GL_EXT_packed_pixels
+#define GL_EXT_packed_pixels 1
+
+#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034
+#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035
+#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036
+
+#define GLEW_EXT_packed_pixels GLEW_GET_VAR(__GLEW_EXT_packed_pixels)
+
+#endif /* GL_EXT_packed_pixels */
+
+/* ------------------------ GL_EXT_paletted_texture ------------------------ */
+
+#ifndef GL_EXT_paletted_texture
+#define GL_EXT_paletted_texture 1
+
+#define GL_TEXTURE_1D 0x0DE0
+#define GL_TEXTURE_2D 0x0DE1
+#define GL_PROXY_TEXTURE_1D 0x8063
+#define GL_PROXY_TEXTURE_2D 0x8064
+#define GL_TEXTURE_3D_EXT 0x806F
+#define GL_PROXY_TEXTURE_3D_EXT 0x8070
+#define GL_COLOR_TABLE_FORMAT_EXT 0x80D8
+#define GL_COLOR_TABLE_WIDTH_EXT 0x80D9
+#define GL_COLOR_TABLE_RED_SIZE_EXT 0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE_EXT 0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE_EXT 0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE_EXT 0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE_EXT 0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE_EXT 0x80DF
+#define GL_COLOR_INDEX1_EXT 0x80E2
+#define GL_COLOR_INDEX2_EXT 0x80E3
+#define GL_COLOR_INDEX4_EXT 0x80E4
+#define GL_COLOR_INDEX8_EXT 0x80E5
+#define GL_COLOR_INDEX12_EXT 0x80E6
+#define GL_COLOR_INDEX16_EXT 0x80E7
+#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED
+#define GL_TEXTURE_CUBE_MAP_ARB 0x8513
+#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B
+
+typedef void (GLAPIENTRY * PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const void* data);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, void* data);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint* params);
+
+#define glColorTableEXT GLEW_GET_FUN(__glewColorTableEXT)
+#define glGetColorTableEXT GLEW_GET_FUN(__glewGetColorTableEXT)
+#define glGetColorTableParameterfvEXT GLEW_GET_FUN(__glewGetColorTableParameterfvEXT)
+#define glGetColorTableParameterivEXT GLEW_GET_FUN(__glewGetColorTableParameterivEXT)
+
+#define GLEW_EXT_paletted_texture GLEW_GET_VAR(__GLEW_EXT_paletted_texture)
+
+#endif /* GL_EXT_paletted_texture */
+
+/* ----------------------- GL_EXT_pixel_buffer_object ---------------------- */
+
+#ifndef GL_EXT_pixel_buffer_object
+#define GL_EXT_pixel_buffer_object 1
+
+#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB
+#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC
+#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED
+#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF
+
+#define GLEW_EXT_pixel_buffer_object GLEW_GET_VAR(__GLEW_EXT_pixel_buffer_object)
+
+#endif /* GL_EXT_pixel_buffer_object */
+
+/* ------------------------- GL_EXT_pixel_transform ------------------------ */
+
+#ifndef GL_EXT_pixel_transform
+#define GL_EXT_pixel_transform 1
+
+#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330
+#define GL_PIXEL_MAG_FILTER_EXT 0x8331
+#define GL_PIXEL_MIN_FILTER_EXT 0x8332
+#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333
+#define GL_CUBIC_EXT 0x8334
+#define GL_AVERAGE_EXT 0x8335
+#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336
+#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337
+#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338
+
+typedef void (GLAPIENTRY * PFNGLGETPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, const GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, const GLint param);
+typedef void (GLAPIENTRY * PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint* params);
+
+#define glGetPixelTransformParameterfvEXT GLEW_GET_FUN(__glewGetPixelTransformParameterfvEXT)
+#define glGetPixelTransformParameterivEXT GLEW_GET_FUN(__glewGetPixelTransformParameterivEXT)
+#define glPixelTransformParameterfEXT GLEW_GET_FUN(__glewPixelTransformParameterfEXT)
+#define glPixelTransformParameterfvEXT GLEW_GET_FUN(__glewPixelTransformParameterfvEXT)
+#define glPixelTransformParameteriEXT GLEW_GET_FUN(__glewPixelTransformParameteriEXT)
+#define glPixelTransformParameterivEXT GLEW_GET_FUN(__glewPixelTransformParameterivEXT)
+
+#define GLEW_EXT_pixel_transform GLEW_GET_VAR(__GLEW_EXT_pixel_transform)
+
+#endif /* GL_EXT_pixel_transform */
+
+/* ------------------- GL_EXT_pixel_transform_color_table ------------------ */
+
+#ifndef GL_EXT_pixel_transform_color_table
+#define GL_EXT_pixel_transform_color_table 1
+
+#define GLEW_EXT_pixel_transform_color_table GLEW_GET_VAR(__GLEW_EXT_pixel_transform_color_table)
+
+#endif /* GL_EXT_pixel_transform_color_table */
+
+/* ------------------------ GL_EXT_point_parameters ------------------------ */
+
+#ifndef GL_EXT_point_parameters
+#define GL_EXT_point_parameters 1
+
+#define GL_POINT_SIZE_MIN_EXT 0x8126
+#define GL_POINT_SIZE_MAX_EXT 0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128
+#define GL_DISTANCE_ATTENUATION_EXT 0x8129
+
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, GLfloat* params);
+
+#define glPointParameterfEXT GLEW_GET_FUN(__glewPointParameterfEXT)
+#define glPointParameterfvEXT GLEW_GET_FUN(__glewPointParameterfvEXT)
+
+#define GLEW_EXT_point_parameters GLEW_GET_VAR(__GLEW_EXT_point_parameters)
+
+#endif /* GL_EXT_point_parameters */
+
+/* ------------------------- GL_EXT_polygon_offset ------------------------- */
+
+#ifndef GL_EXT_polygon_offset
+#define GL_EXT_polygon_offset 1
+
+#define GL_POLYGON_OFFSET_EXT 0x8037
+#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038
+#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039
+
+typedef void (GLAPIENTRY * PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias);
+
+#define glPolygonOffsetEXT GLEW_GET_FUN(__glewPolygonOffsetEXT)
+
+#define GLEW_EXT_polygon_offset GLEW_GET_VAR(__GLEW_EXT_polygon_offset)
+
+#endif /* GL_EXT_polygon_offset */
+
+/* ------------------------- GL_EXT_rescale_normal ------------------------- */
+
+#ifndef GL_EXT_rescale_normal
+#define GL_EXT_rescale_normal 1
+
+#define GLEW_EXT_rescale_normal GLEW_GET_VAR(__GLEW_EXT_rescale_normal)
+
+#endif /* GL_EXT_rescale_normal */
+
+/* -------------------------- GL_EXT_scene_marker -------------------------- */
+
+#ifndef GL_EXT_scene_marker
+#define GL_EXT_scene_marker 1
+
+typedef void (GLAPIENTRY * PFNGLBEGINSCENEEXTPROC) (void);
+typedef void (GLAPIENTRY * PFNGLENDSCENEEXTPROC) (void);
+
+#define glBeginSceneEXT GLEW_GET_FUN(__glewBeginSceneEXT)
+#define glEndSceneEXT GLEW_GET_FUN(__glewEndSceneEXT)
+
+#define GLEW_EXT_scene_marker GLEW_GET_VAR(__GLEW_EXT_scene_marker)
+
+#endif /* GL_EXT_scene_marker */
+
+/* ------------------------- GL_EXT_secondary_color ------------------------ */
+
+#ifndef GL_EXT_secondary_color
+#define GL_EXT_secondary_color 1
+
+#define GL_COLOR_SUM_EXT 0x8458
+#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459
+#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A
+#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B
+#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C
+#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D
+#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E
+
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLvoid *pointer);
+
+#define glSecondaryColor3bEXT GLEW_GET_FUN(__glewSecondaryColor3bEXT)
+#define glSecondaryColor3bvEXT GLEW_GET_FUN(__glewSecondaryColor3bvEXT)
+#define glSecondaryColor3dEXT GLEW_GET_FUN(__glewSecondaryColor3dEXT)
+#define glSecondaryColor3dvEXT GLEW_GET_FUN(__glewSecondaryColor3dvEXT)
+#define glSecondaryColor3fEXT GLEW_GET_FUN(__glewSecondaryColor3fEXT)
+#define glSecondaryColor3fvEXT GLEW_GET_FUN(__glewSecondaryColor3fvEXT)
+#define glSecondaryColor3iEXT GLEW_GET_FUN(__glewSecondaryColor3iEXT)
+#define glSecondaryColor3ivEXT GLEW_GET_FUN(__glewSecondaryColor3ivEXT)
+#define glSecondaryColor3sEXT GLEW_GET_FUN(__glewSecondaryColor3sEXT)
+#define glSecondaryColor3svEXT GLEW_GET_FUN(__glewSecondaryColor3svEXT)
+#define glSecondaryColor3ubEXT GLEW_GET_FUN(__glewSecondaryColor3ubEXT)
+#define glSecondaryColor3ubvEXT GLEW_GET_FUN(__glewSecondaryColor3ubvEXT)
+#define glSecondaryColor3uiEXT GLEW_GET_FUN(__glewSecondaryColor3uiEXT)
+#define glSecondaryColor3uivEXT GLEW_GET_FUN(__glewSecondaryColor3uivEXT)
+#define glSecondaryColor3usEXT GLEW_GET_FUN(__glewSecondaryColor3usEXT)
+#define glSecondaryColor3usvEXT GLEW_GET_FUN(__glewSecondaryColor3usvEXT)
+#define glSecondaryColorPointerEXT GLEW_GET_FUN(__glewSecondaryColorPointerEXT)
+
+#define GLEW_EXT_secondary_color GLEW_GET_VAR(__GLEW_EXT_secondary_color)
+
+#endif /* GL_EXT_secondary_color */
+
+/* --------------------- GL_EXT_separate_specular_color -------------------- */
+
+#ifndef GL_EXT_separate_specular_color
+#define GL_EXT_separate_specular_color 1
+
+#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8
+#define GL_SINGLE_COLOR_EXT 0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA
+
+#define GLEW_EXT_separate_specular_color GLEW_GET_VAR(__GLEW_EXT_separate_specular_color)
+
+#endif /* GL_EXT_separate_specular_color */
+
+/* -------------------------- GL_EXT_shadow_funcs -------------------------- */
+
+#ifndef GL_EXT_shadow_funcs
+#define GL_EXT_shadow_funcs 1
+
+#define GLEW_EXT_shadow_funcs GLEW_GET_VAR(__GLEW_EXT_shadow_funcs)
+
+#endif /* GL_EXT_shadow_funcs */
+
+/* --------------------- GL_EXT_shared_texture_palette --------------------- */
+
+#ifndef GL_EXT_shared_texture_palette
+#define GL_EXT_shared_texture_palette 1
+
+#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB
+
+#define GLEW_EXT_shared_texture_palette GLEW_GET_VAR(__GLEW_EXT_shared_texture_palette)
+
+#endif /* GL_EXT_shared_texture_palette */
+
+/* ------------------------ GL_EXT_stencil_clear_tag ----------------------- */
+
+#ifndef GL_EXT_stencil_clear_tag
+#define GL_EXT_stencil_clear_tag 1
+
+#define GL_STENCIL_TAG_BITS_EXT 0x88F2
+#define GL_STENCIL_CLEAR_TAG_VALUE_EXT 0x88F3
+
+#define GLEW_EXT_stencil_clear_tag GLEW_GET_VAR(__GLEW_EXT_stencil_clear_tag)
+
+#endif /* GL_EXT_stencil_clear_tag */
+
+/* ------------------------ GL_EXT_stencil_two_side ------------------------ */
+
+#ifndef GL_EXT_stencil_two_side
+#define GL_EXT_stencil_two_side 1
+
+#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910
+#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911
+
+typedef void (GLAPIENTRY * PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face);
+
+#define glActiveStencilFaceEXT GLEW_GET_FUN(__glewActiveStencilFaceEXT)
+
+#define GLEW_EXT_stencil_two_side GLEW_GET_VAR(__GLEW_EXT_stencil_two_side)
+
+#endif /* GL_EXT_stencil_two_side */
+
+/* -------------------------- GL_EXT_stencil_wrap -------------------------- */
+
+#ifndef GL_EXT_stencil_wrap
+#define GL_EXT_stencil_wrap 1
+
+#define GL_INCR_WRAP_EXT 0x8507
+#define GL_DECR_WRAP_EXT 0x8508
+
+#define GLEW_EXT_stencil_wrap GLEW_GET_VAR(__GLEW_EXT_stencil_wrap)
+
+#endif /* GL_EXT_stencil_wrap */
+
+/* --------------------------- GL_EXT_subtexture --------------------------- */
+
+#ifndef GL_EXT_subtexture
+#define GL_EXT_subtexture 1
+
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const void* pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const void* pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const void* pixels);
+
+#define glTexSubImage1DEXT GLEW_GET_FUN(__glewTexSubImage1DEXT)
+#define glTexSubImage2DEXT GLEW_GET_FUN(__glewTexSubImage2DEXT)
+#define glTexSubImage3DEXT GLEW_GET_FUN(__glewTexSubImage3DEXT)
+
+#define GLEW_EXT_subtexture GLEW_GET_VAR(__GLEW_EXT_subtexture)
+
+#endif /* GL_EXT_subtexture */
+
+/* ----------------------------- GL_EXT_texture ---------------------------- */
+
+#ifndef GL_EXT_texture
+#define GL_EXT_texture 1
+
+#define GL_ALPHA4_EXT 0x803B
+#define GL_ALPHA8_EXT 0x803C
+#define GL_ALPHA12_EXT 0x803D
+#define GL_ALPHA16_EXT 0x803E
+#define GL_LUMINANCE4_EXT 0x803F
+#define GL_LUMINANCE8_EXT 0x8040
+#define GL_LUMINANCE12_EXT 0x8041
+#define GL_LUMINANCE16_EXT 0x8042
+#define GL_LUMINANCE4_ALPHA4_EXT 0x8043
+#define GL_LUMINANCE6_ALPHA2_EXT 0x8044
+#define GL_LUMINANCE8_ALPHA8_EXT 0x8045
+#define GL_LUMINANCE12_ALPHA4_EXT 0x8046
+#define GL_LUMINANCE12_ALPHA12_EXT 0x8047
+#define GL_LUMINANCE16_ALPHA16_EXT 0x8048
+#define GL_INTENSITY_EXT 0x8049
+#define GL_INTENSITY4_EXT 0x804A
+#define GL_INTENSITY8_EXT 0x804B
+#define GL_INTENSITY12_EXT 0x804C
+#define GL_INTENSITY16_EXT 0x804D
+#define GL_RGB2_EXT 0x804E
+#define GL_RGB4_EXT 0x804F
+#define GL_RGB5_EXT 0x8050
+#define GL_RGB8_EXT 0x8051
+#define GL_RGB10_EXT 0x8052
+#define GL_RGB12_EXT 0x8053
+#define GL_RGB16_EXT 0x8054
+#define GL_RGBA2_EXT 0x8055
+#define GL_RGBA4_EXT 0x8056
+#define GL_RGB5_A1_EXT 0x8057
+#define GL_RGBA8_EXT 0x8058
+#define GL_RGB10_A2_EXT 0x8059
+#define GL_RGBA12_EXT 0x805A
+#define GL_RGBA16_EXT 0x805B
+#define GL_TEXTURE_RED_SIZE_EXT 0x805C
+#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D
+#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E
+#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F
+#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060
+#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061
+#define GL_REPLACE_EXT 0x8062
+#define GL_PROXY_TEXTURE_1D_EXT 0x8063
+#define GL_PROXY_TEXTURE_2D_EXT 0x8064
+
+#define GLEW_EXT_texture GLEW_GET_VAR(__GLEW_EXT_texture)
+
+#endif /* GL_EXT_texture */
+
+/* ---------------------------- GL_EXT_texture3D --------------------------- */
+
+#ifndef GL_EXT_texture3D
+#define GL_EXT_texture3D 1
+
+#define GL_PACK_SKIP_IMAGES_EXT 0x806B
+#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C
+#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D
+#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E
+#define GL_TEXTURE_3D_EXT 0x806F
+#define GL_PROXY_TEXTURE_3D_EXT 0x8070
+#define GL_TEXTURE_DEPTH_EXT 0x8071
+#define GL_TEXTURE_WRAP_R_EXT 0x8072
+#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073
+
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const void* pixels);
+
+#define glTexImage3DEXT GLEW_GET_FUN(__glewTexImage3DEXT)
+
+#define GLEW_EXT_texture3D GLEW_GET_VAR(__GLEW_EXT_texture3D)
+
+#endif /* GL_EXT_texture3D */
+
+/* -------------------- GL_EXT_texture_compression_dxt1 -------------------- */
+
+#ifndef GL_EXT_texture_compression_dxt1
+#define GL_EXT_texture_compression_dxt1 1
+
+#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0
+#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1
+
+#define GLEW_EXT_texture_compression_dxt1 GLEW_GET_VAR(__GLEW_EXT_texture_compression_dxt1)
+
+#endif /* GL_EXT_texture_compression_dxt1 */
+
+/* -------------------- GL_EXT_texture_compression_s3tc -------------------- */
+
+#ifndef GL_EXT_texture_compression_s3tc
+#define GL_EXT_texture_compression_s3tc 1
+
+#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0
+#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1
+#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2
+#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3
+
+#define GLEW_EXT_texture_compression_s3tc GLEW_GET_VAR(__GLEW_EXT_texture_compression_s3tc)
+
+#endif /* GL_EXT_texture_compression_s3tc */
+
+/* ------------------------ GL_EXT_texture_cube_map ------------------------ */
+
+#ifndef GL_EXT_texture_cube_map
+#define GL_EXT_texture_cube_map 1
+
+#define GL_NORMAL_MAP_EXT 0x8511
+#define GL_REFLECTION_MAP_EXT 0x8512
+#define GL_TEXTURE_CUBE_MAP_EXT 0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C
+
+#define GLEW_EXT_texture_cube_map GLEW_GET_VAR(__GLEW_EXT_texture_cube_map)
+
+#endif /* GL_EXT_texture_cube_map */
+
+/* ----------------------- GL_EXT_texture_edge_clamp ----------------------- */
+
+#ifndef GL_EXT_texture_edge_clamp
+#define GL_EXT_texture_edge_clamp 1
+
+#define GL_CLAMP_TO_EDGE_EXT 0x812F
+
+#define GLEW_EXT_texture_edge_clamp GLEW_GET_VAR(__GLEW_EXT_texture_edge_clamp)
+
+#endif /* GL_EXT_texture_edge_clamp */
+
+/* --------------------------- GL_EXT_texture_env -------------------------- */
+
+#ifndef GL_EXT_texture_env
+#define GL_EXT_texture_env 1
+
+#define GL_TEXTURE_ENV0_EXT 0
+#define GL_ENV_BLEND_EXT 0
+#define GL_TEXTURE_ENV_SHIFT_EXT 0
+#define GL_ENV_REPLACE_EXT 0
+#define GL_ENV_ADD_EXT 0
+#define GL_ENV_SUBTRACT_EXT 0
+#define GL_TEXTURE_ENV_MODE_ALPHA_EXT 0
+#define GL_ENV_REVERSE_SUBTRACT_EXT 0
+#define GL_ENV_REVERSE_BLEND_EXT 0
+#define GL_ENV_COPY_EXT 0
+#define GL_ENV_MODULATE_EXT 0
+
+#define GLEW_EXT_texture_env GLEW_GET_VAR(__GLEW_EXT_texture_env)
+
+#endif /* GL_EXT_texture_env */
+
+/* ------------------------- GL_EXT_texture_env_add ------------------------ */
+
+#ifndef GL_EXT_texture_env_add
+#define GL_EXT_texture_env_add 1
+
+#define GLEW_EXT_texture_env_add GLEW_GET_VAR(__GLEW_EXT_texture_env_add)
+
+#endif /* GL_EXT_texture_env_add */
+
+/* ----------------------- GL_EXT_texture_env_combine ---------------------- */
+
+#ifndef GL_EXT_texture_env_combine
+#define GL_EXT_texture_env_combine 1
+
+#define GL_COMBINE_EXT 0x8570
+#define GL_COMBINE_RGB_EXT 0x8571
+#define GL_COMBINE_ALPHA_EXT 0x8572
+#define GL_RGB_SCALE_EXT 0x8573
+#define GL_ADD_SIGNED_EXT 0x8574
+#define GL_INTERPOLATE_EXT 0x8575
+#define GL_CONSTANT_EXT 0x8576
+#define GL_PRIMARY_COLOR_EXT 0x8577
+#define GL_PREVIOUS_EXT 0x8578
+#define GL_SOURCE0_RGB_EXT 0x8580
+#define GL_SOURCE1_RGB_EXT 0x8581
+#define GL_SOURCE2_RGB_EXT 0x8582
+#define GL_SOURCE0_ALPHA_EXT 0x8588
+#define GL_SOURCE1_ALPHA_EXT 0x8589
+#define GL_SOURCE2_ALPHA_EXT 0x858A
+#define GL_OPERAND0_RGB_EXT 0x8590
+#define GL_OPERAND1_RGB_EXT 0x8591
+#define GL_OPERAND2_RGB_EXT 0x8592
+#define GL_OPERAND0_ALPHA_EXT 0x8598
+#define GL_OPERAND1_ALPHA_EXT 0x8599
+#define GL_OPERAND2_ALPHA_EXT 0x859A
+
+#define GLEW_EXT_texture_env_combine GLEW_GET_VAR(__GLEW_EXT_texture_env_combine)
+
+#endif /* GL_EXT_texture_env_combine */
+
+/* ------------------------ GL_EXT_texture_env_dot3 ------------------------ */
+
+#ifndef GL_EXT_texture_env_dot3
+#define GL_EXT_texture_env_dot3 1
+
+#define GL_DOT3_RGB_EXT 0x8740
+#define GL_DOT3_RGBA_EXT 0x8741
+
+#define GLEW_EXT_texture_env_dot3 GLEW_GET_VAR(__GLEW_EXT_texture_env_dot3)
+
+#endif /* GL_EXT_texture_env_dot3 */
+
+/* ------------------- GL_EXT_texture_filter_anisotropic ------------------- */
+
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_EXT_texture_filter_anisotropic 1
+
+#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE
+#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
+
+#define GLEW_EXT_texture_filter_anisotropic GLEW_GET_VAR(__GLEW_EXT_texture_filter_anisotropic)
+
+#endif /* GL_EXT_texture_filter_anisotropic */
+
+/* ------------------------ GL_EXT_texture_lod_bias ------------------------ */
+
+#ifndef GL_EXT_texture_lod_bias
+#define GL_EXT_texture_lod_bias 1
+
+#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD
+#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500
+#define GL_TEXTURE_LOD_BIAS_EXT 0x8501
+
+#define GLEW_EXT_texture_lod_bias GLEW_GET_VAR(__GLEW_EXT_texture_lod_bias)
+
+#endif /* GL_EXT_texture_lod_bias */
+
+/* ---------------------- GL_EXT_texture_mirror_clamp ---------------------- */
+
+#ifndef GL_EXT_texture_mirror_clamp
+#define GL_EXT_texture_mirror_clamp 1
+
+#define GL_MIRROR_CLAMP_EXT 0x8742
+#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743
+#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912
+
+#define GLEW_EXT_texture_mirror_clamp GLEW_GET_VAR(__GLEW_EXT_texture_mirror_clamp)
+
+#endif /* GL_EXT_texture_mirror_clamp */
+
+/* ------------------------- GL_EXT_texture_object ------------------------- */
+
+#ifndef GL_EXT_texture_object
+#define GL_EXT_texture_object 1
+
+#define GL_TEXTURE_PRIORITY_EXT 0x8066
+#define GL_TEXTURE_RESIDENT_EXT 0x8067
+#define GL_TEXTURE_1D_BINDING_EXT 0x8068
+#define GL_TEXTURE_2D_BINDING_EXT 0x8069
+#define GL_TEXTURE_3D_BINDING_EXT 0x806A
+
+typedef GLboolean (GLAPIENTRY * PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint* textures, GLboolean* residences);
+typedef void (GLAPIENTRY * PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture);
+typedef void (GLAPIENTRY * PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint* textures);
+typedef void (GLAPIENTRY * PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint* textures);
+typedef GLboolean (GLAPIENTRY * PFNGLISTEXTUREEXTPROC) (GLuint texture);
+typedef void (GLAPIENTRY * PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint* textures, const GLclampf* priorities);
+
+#define glAreTexturesResidentEXT GLEW_GET_FUN(__glewAreTexturesResidentEXT)
+#define glBindTextureEXT GLEW_GET_FUN(__glewBindTextureEXT)
+#define glDeleteTexturesEXT GLEW_GET_FUN(__glewDeleteTexturesEXT)
+#define glGenTexturesEXT GLEW_GET_FUN(__glewGenTexturesEXT)
+#define glIsTextureEXT GLEW_GET_FUN(__glewIsTextureEXT)
+#define glPrioritizeTexturesEXT GLEW_GET_FUN(__glewPrioritizeTexturesEXT)
+
+#define GLEW_EXT_texture_object GLEW_GET_VAR(__GLEW_EXT_texture_object)
+
+#endif /* GL_EXT_texture_object */
+
+/* --------------------- GL_EXT_texture_perturb_normal --------------------- */
+
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_EXT_texture_perturb_normal 1
+
+#define GL_PERTURB_EXT 0x85AE
+#define GL_TEXTURE_NORMAL_EXT 0x85AF
+
+typedef void (GLAPIENTRY * PFNGLTEXTURENORMALEXTPROC) (GLenum mode);
+
+#define glTextureNormalEXT GLEW_GET_FUN(__glewTextureNormalEXT)
+
+#define GLEW_EXT_texture_perturb_normal GLEW_GET_VAR(__GLEW_EXT_texture_perturb_normal)
+
+#endif /* GL_EXT_texture_perturb_normal */
+
+/* ------------------------ GL_EXT_texture_rectangle ----------------------- */
+
+#ifndef GL_EXT_texture_rectangle
+#define GL_EXT_texture_rectangle 1
+
+#define GL_TEXTURE_RECTANGLE_EXT 0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_EXT 0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_EXT 0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_EXT 0x84F8
+
+#define GLEW_EXT_texture_rectangle GLEW_GET_VAR(__GLEW_EXT_texture_rectangle)
+
+#endif /* GL_EXT_texture_rectangle */
+
+/* -------------------------- GL_EXT_texture_sRGB -------------------------- */
+
+#ifndef GL_EXT_texture_sRGB
+#define GL_EXT_texture_sRGB 1
+
+#define GL_SRGB_EXT 0x8C40
+#define GL_SRGB8_EXT 0x8C41
+#define GL_SRGB_ALPHA_EXT 0x8C42
+#define GL_SRGB8_ALPHA8_EXT 0x8C43
+#define GL_SLUMINANCE_ALPHA_EXT 0x8C44
+#define GL_SLUMINANCE8_ALPHA8_EXT 0x8C45
+#define GL_SLUMINANCE_EXT 0x8C46
+#define GL_SLUMINANCE8_EXT 0x8C47
+#define GL_COMPRESSED_SRGB_EXT 0x8C48
+#define GL_COMPRESSED_SRGB_ALPHA_EXT 0x8C49
+#define GL_COMPRESSED_SLUMINANCE_EXT 0x8C4A
+#define GL_COMPRESSED_SLUMINANCE_ALPHA_EXT 0x8C4B
+#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C
+#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D
+#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E
+#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F
+
+#define GLEW_EXT_texture_sRGB GLEW_GET_VAR(__GLEW_EXT_texture_sRGB)
+
+#endif /* GL_EXT_texture_sRGB */
+
+/* -------------------------- GL_EXT_vertex_array -------------------------- */
+
+#ifndef GL_EXT_vertex_array
+#define GL_EXT_vertex_array 1
+
+#define GL_DOUBLE_EXT 0x140A
+#define GL_VERTEX_ARRAY_EXT 0x8074
+#define GL_NORMAL_ARRAY_EXT 0x8075
+#define GL_COLOR_ARRAY_EXT 0x8076
+#define GL_INDEX_ARRAY_EXT 0x8077
+#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078
+#define GL_EDGE_FLAG_ARRAY_EXT 0x8079
+#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A
+#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B
+#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C
+#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D
+#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E
+#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F
+#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080
+#define GL_COLOR_ARRAY_SIZE_EXT 0x8081
+#define GL_COLOR_ARRAY_TYPE_EXT 0x8082
+#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083
+#define GL_COLOR_ARRAY_COUNT_EXT 0x8084
+#define GL_INDEX_ARRAY_TYPE_EXT 0x8085
+#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086
+#define GL_INDEX_ARRAY_COUNT_EXT 0x8087
+#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088
+#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089
+#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A
+#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B
+#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C
+#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D
+#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E
+#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F
+#define GL_COLOR_ARRAY_POINTER_EXT 0x8090
+#define GL_INDEX_ARRAY_POINTER_EXT 0x8091
+#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092
+#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093
+
+typedef void (GLAPIENTRY * PFNGLARRAYELEMENTEXTPROC) (GLint i);
+typedef void (GLAPIENTRY * PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count);
+typedef void (GLAPIENTRY * PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean* pointer);
+typedef void (GLAPIENTRY * PFNGLGETPOINTERVEXTPROC) (GLenum pname, void** params);
+typedef void (GLAPIENTRY * PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const void* pointer);
+
+#define glArrayElementEXT GLEW_GET_FUN(__glewArrayElementEXT)
+#define glColorPointerEXT GLEW_GET_FUN(__glewColorPointerEXT)
+#define glDrawArraysEXT GLEW_GET_FUN(__glewDrawArraysEXT)
+#define glEdgeFlagPointerEXT GLEW_GET_FUN(__glewEdgeFlagPointerEXT)
+#define glGetPointervEXT GLEW_GET_FUN(__glewGetPointervEXT)
+#define glIndexPointerEXT GLEW_GET_FUN(__glewIndexPointerEXT)
+#define glNormalPointerEXT GLEW_GET_FUN(__glewNormalPointerEXT)
+#define glTexCoordPointerEXT GLEW_GET_FUN(__glewTexCoordPointerEXT)
+#define glVertexPointerEXT GLEW_GET_FUN(__glewVertexPointerEXT)
+
+#define GLEW_EXT_vertex_array GLEW_GET_VAR(__GLEW_EXT_vertex_array)
+
+#endif /* GL_EXT_vertex_array */
+
+/* -------------------------- GL_EXT_vertex_shader ------------------------- */
+
+#ifndef GL_EXT_vertex_shader
+#define GL_EXT_vertex_shader 1
+
+#define GL_VERTEX_SHADER_EXT 0x8780
+#define GL_VERTEX_SHADER_BINDING_EXT 0x8781
+#define GL_OP_INDEX_EXT 0x8782
+#define GL_OP_NEGATE_EXT 0x8783
+#define GL_OP_DOT3_EXT 0x8784
+#define GL_OP_DOT4_EXT 0x8785
+#define GL_OP_MUL_EXT 0x8786
+#define GL_OP_ADD_EXT 0x8787
+#define GL_OP_MADD_EXT 0x8788
+#define GL_OP_FRAC_EXT 0x8789
+#define GL_OP_MAX_EXT 0x878A
+#define GL_OP_MIN_EXT 0x878B
+#define GL_OP_SET_GE_EXT 0x878C
+#define GL_OP_SET_LT_EXT 0x878D
+#define GL_OP_CLAMP_EXT 0x878E
+#define GL_OP_FLOOR_EXT 0x878F
+#define GL_OP_ROUND_EXT 0x8790
+#define GL_OP_EXP_BASE_2_EXT 0x8791
+#define GL_OP_LOG_BASE_2_EXT 0x8792
+#define GL_OP_POWER_EXT 0x8793
+#define GL_OP_RECIP_EXT 0x8794
+#define GL_OP_RECIP_SQRT_EXT 0x8795
+#define GL_OP_SUB_EXT 0x8796
+#define GL_OP_CROSS_PRODUCT_EXT 0x8797
+#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798
+#define GL_OP_MOV_EXT 0x8799
+#define GL_OUTPUT_VERTEX_EXT 0x879A
+#define GL_OUTPUT_COLOR0_EXT 0x879B
+#define GL_OUTPUT_COLOR1_EXT 0x879C
+#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D
+#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E
+#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F
+#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0
+#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1
+#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2
+#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3
+#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4
+#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5
+#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6
+#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7
+#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8
+#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9
+#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA
+#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB
+#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC
+#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD
+#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE
+#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF
+#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0
+#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1
+#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2
+#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3
+#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4
+#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5
+#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6
+#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7
+#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8
+#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9
+#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA
+#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB
+#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC
+#define GL_OUTPUT_FOG_EXT 0x87BD
+#define GL_SCALAR_EXT 0x87BE
+#define GL_VECTOR_EXT 0x87BF
+#define GL_MATRIX_EXT 0x87C0
+#define GL_VARIANT_EXT 0x87C1
+#define GL_INVARIANT_EXT 0x87C2
+#define GL_LOCAL_CONSTANT_EXT 0x87C3
+#define GL_LOCAL_EXT 0x87C4
+#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5
+#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6
+#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7
+#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8
+#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CC
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CD
+#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE
+#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF
+#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0
+#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1
+#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2
+#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3
+#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4
+#define GL_X_EXT 0x87D5
+#define GL_Y_EXT 0x87D6
+#define GL_Z_EXT 0x87D7
+#define GL_W_EXT 0x87D8
+#define GL_NEGATIVE_X_EXT 0x87D9
+#define GL_NEGATIVE_Y_EXT 0x87DA
+#define GL_NEGATIVE_Z_EXT 0x87DB
+#define GL_NEGATIVE_W_EXT 0x87DC
+#define GL_ZERO_EXT 0x87DD
+#define GL_ONE_EXT 0x87DE
+#define GL_NEGATIVE_ONE_EXT 0x87DF
+#define GL_NORMALIZED_RANGE_EXT 0x87E0
+#define GL_FULL_RANGE_EXT 0x87E1
+#define GL_CURRENT_VERTEX_EXT 0x87E2
+#define GL_MVP_MATRIX_EXT 0x87E3
+#define GL_VARIANT_VALUE_EXT 0x87E4
+#define GL_VARIANT_DATATYPE_EXT 0x87E5
+#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6
+#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7
+#define GL_VARIANT_ARRAY_EXT 0x87E8
+#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9
+#define GL_INVARIANT_VALUE_EXT 0x87EA
+#define GL_INVARIANT_DATATYPE_EXT 0x87EB
+#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC
+#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED
+
+typedef void (GLAPIENTRY * PFNGLBEGINVERTEXSHADEREXTPROC) (void);
+typedef GLuint (GLAPIENTRY * PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value);
+typedef GLuint (GLAPIENTRY * PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value);
+typedef GLuint (GLAPIENTRY * PFNGLBINDPARAMETEREXTPROC) (GLenum value);
+typedef GLuint (GLAPIENTRY * PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value);
+typedef GLuint (GLAPIENTRY * PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value);
+typedef void (GLAPIENTRY * PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLENDVERTEXSHADEREXTPROC) (void);
+typedef void (GLAPIENTRY * PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef GLuint (GLAPIENTRY * PFNGLGENSYMBOLSEXTPROC) (GLenum dataType, GLenum storageType, GLenum range, GLuint components);
+typedef GLuint (GLAPIENTRY * PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range);
+typedef void (GLAPIENTRY * PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (GLAPIENTRY * PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (GLAPIENTRY * PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (GLAPIENTRY * PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (GLAPIENTRY * PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (GLAPIENTRY * PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
+typedef void (GLAPIENTRY * PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid **data);
+typedef void (GLAPIENTRY * PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
+typedef GLboolean (GLAPIENTRY * PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap);
+typedef void (GLAPIENTRY * PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, GLvoid *addr);
+typedef void (GLAPIENTRY * PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, GLvoid *addr);
+typedef void (GLAPIENTRY * PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1);
+typedef void (GLAPIENTRY * PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2);
+typedef void (GLAPIENTRY * PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3);
+typedef void (GLAPIENTRY * PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+typedef void (GLAPIENTRY * PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, GLvoid *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTBVEXTPROC) (GLuint id, GLbyte *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTDVEXTPROC) (GLuint id, GLdouble *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTFVEXTPROC) (GLuint id, GLfloat *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTIVEXTPROC) (GLuint id, GLint *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTSVEXTPROC) (GLuint id, GLshort *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTUBVEXTPROC) (GLuint id, GLubyte *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTUIVEXTPROC) (GLuint id, GLuint *addr);
+typedef void (GLAPIENTRY * PFNGLVARIANTUSVEXTPROC) (GLuint id, GLushort *addr);
+typedef void (GLAPIENTRY * PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
+
+#define glBeginVertexShaderEXT GLEW_GET_FUN(__glewBeginVertexShaderEXT)
+#define glBindLightParameterEXT GLEW_GET_FUN(__glewBindLightParameterEXT)
+#define glBindMaterialParameterEXT GLEW_GET_FUN(__glewBindMaterialParameterEXT)
+#define glBindParameterEXT GLEW_GET_FUN(__glewBindParameterEXT)
+#define glBindTexGenParameterEXT GLEW_GET_FUN(__glewBindTexGenParameterEXT)
+#define glBindTextureUnitParameterEXT GLEW_GET_FUN(__glewBindTextureUnitParameterEXT)
+#define glBindVertexShaderEXT GLEW_GET_FUN(__glewBindVertexShaderEXT)
+#define glDeleteVertexShaderEXT GLEW_GET_FUN(__glewDeleteVertexShaderEXT)
+#define glDisableVariantClientStateEXT GLEW_GET_FUN(__glewDisableVariantClientStateEXT)
+#define glEnableVariantClientStateEXT GLEW_GET_FUN(__glewEnableVariantClientStateEXT)
+#define glEndVertexShaderEXT GLEW_GET_FUN(__glewEndVertexShaderEXT)
+#define glExtractComponentEXT GLEW_GET_FUN(__glewExtractComponentEXT)
+#define glGenSymbolsEXT GLEW_GET_FUN(__glewGenSymbolsEXT)
+#define glGenVertexShadersEXT GLEW_GET_FUN(__glewGenVertexShadersEXT)
+#define glGetInvariantBooleanvEXT GLEW_GET_FUN(__glewGetInvariantBooleanvEXT)
+#define glGetInvariantFloatvEXT GLEW_GET_FUN(__glewGetInvariantFloatvEXT)
+#define glGetInvariantIntegervEXT GLEW_GET_FUN(__glewGetInvariantIntegervEXT)
+#define glGetLocalConstantBooleanvEXT GLEW_GET_FUN(__glewGetLocalConstantBooleanvEXT)
+#define glGetLocalConstantFloatvEXT GLEW_GET_FUN(__glewGetLocalConstantFloatvEXT)
+#define glGetLocalConstantIntegervEXT GLEW_GET_FUN(__glewGetLocalConstantIntegervEXT)
+#define glGetVariantBooleanvEXT GLEW_GET_FUN(__glewGetVariantBooleanvEXT)
+#define glGetVariantFloatvEXT GLEW_GET_FUN(__glewGetVariantFloatvEXT)
+#define glGetVariantIntegervEXT GLEW_GET_FUN(__glewGetVariantIntegervEXT)
+#define glGetVariantPointervEXT GLEW_GET_FUN(__glewGetVariantPointervEXT)
+#define glInsertComponentEXT GLEW_GET_FUN(__glewInsertComponentEXT)
+#define glIsVariantEnabledEXT GLEW_GET_FUN(__glewIsVariantEnabledEXT)
+#define glSetInvariantEXT GLEW_GET_FUN(__glewSetInvariantEXT)
+#define glSetLocalConstantEXT GLEW_GET_FUN(__glewSetLocalConstantEXT)
+#define glShaderOp1EXT GLEW_GET_FUN(__glewShaderOp1EXT)
+#define glShaderOp2EXT GLEW_GET_FUN(__glewShaderOp2EXT)
+#define glShaderOp3EXT GLEW_GET_FUN(__glewShaderOp3EXT)
+#define glSwizzleEXT GLEW_GET_FUN(__glewSwizzleEXT)
+#define glVariantPointerEXT GLEW_GET_FUN(__glewVariantPointerEXT)
+#define glVariantbvEXT GLEW_GET_FUN(__glewVariantbvEXT)
+#define glVariantdvEXT GLEW_GET_FUN(__glewVariantdvEXT)
+#define glVariantfvEXT GLEW_GET_FUN(__glewVariantfvEXT)
+#define glVariantivEXT GLEW_GET_FUN(__glewVariantivEXT)
+#define glVariantsvEXT GLEW_GET_FUN(__glewVariantsvEXT)
+#define glVariantubvEXT GLEW_GET_FUN(__glewVariantubvEXT)
+#define glVariantuivEXT GLEW_GET_FUN(__glewVariantuivEXT)
+#define glVariantusvEXT GLEW_GET_FUN(__glewVariantusvEXT)
+#define glWriteMaskEXT GLEW_GET_FUN(__glewWriteMaskEXT)
+
+#define GLEW_EXT_vertex_shader GLEW_GET_VAR(__GLEW_EXT_vertex_shader)
+
+#endif /* GL_EXT_vertex_shader */
+
+/* ------------------------ GL_EXT_vertex_weighting ------------------------ */
+
+#ifndef GL_EXT_vertex_weighting
+#define GL_EXT_vertex_weighting 1
+
+#define GL_MODELVIEW0_STACK_DEPTH_EXT 0x0BA3
+#define GL_MODELVIEW0_MATRIX_EXT 0x0BA6
+#define GL_MODELVIEW0_EXT 0x1700
+#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502
+#define GL_MODELVIEW1_MATRIX_EXT 0x8506
+#define GL_VERTEX_WEIGHTING_EXT 0x8509
+#define GL_MODELVIEW1_EXT 0x850A
+#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B
+#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C
+#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D
+#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E
+#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F
+#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510
+
+typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, void* pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight);
+typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTFVEXTPROC) (GLfloat* weight);
+
+#define glVertexWeightPointerEXT GLEW_GET_FUN(__glewVertexWeightPointerEXT)
+#define glVertexWeightfEXT GLEW_GET_FUN(__glewVertexWeightfEXT)
+#define glVertexWeightfvEXT GLEW_GET_FUN(__glewVertexWeightfvEXT)
+
+#define GLEW_EXT_vertex_weighting GLEW_GET_VAR(__GLEW_EXT_vertex_weighting)
+
+#endif /* GL_EXT_vertex_weighting */
+
+/* ------------------------ GL_GREMEDY_string_marker ----------------------- */
+
+#ifndef GL_GREMEDY_string_marker
+#define GL_GREMEDY_string_marker 1
+
+typedef void (GLAPIENTRY * PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const void* string);
+
+#define glStringMarkerGREMEDY GLEW_GET_FUN(__glewStringMarkerGREMEDY)
+
+#define GLEW_GREMEDY_string_marker GLEW_GET_VAR(__GLEW_GREMEDY_string_marker)
+
+#endif /* GL_GREMEDY_string_marker */
+
+/* --------------------- GL_HP_convolution_border_modes -------------------- */
+
+#ifndef GL_HP_convolution_border_modes
+#define GL_HP_convolution_border_modes 1
+
+#define GLEW_HP_convolution_border_modes GLEW_GET_VAR(__GLEW_HP_convolution_border_modes)
+
+#endif /* GL_HP_convolution_border_modes */
+
+/* ------------------------- GL_HP_image_transform ------------------------- */
+
+#ifndef GL_HP_image_transform
+#define GL_HP_image_transform 1
+
+typedef void (GLAPIENTRY * PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, const GLfloat param);
+typedef void (GLAPIENTRY * PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, const GLint param);
+typedef void (GLAPIENTRY * PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint* params);
+
+#define glGetImageTransformParameterfvHP GLEW_GET_FUN(__glewGetImageTransformParameterfvHP)
+#define glGetImageTransformParameterivHP GLEW_GET_FUN(__glewGetImageTransformParameterivHP)
+#define glImageTransformParameterfHP GLEW_GET_FUN(__glewImageTransformParameterfHP)
+#define glImageTransformParameterfvHP GLEW_GET_FUN(__glewImageTransformParameterfvHP)
+#define glImageTransformParameteriHP GLEW_GET_FUN(__glewImageTransformParameteriHP)
+#define glImageTransformParameterivHP GLEW_GET_FUN(__glewImageTransformParameterivHP)
+
+#define GLEW_HP_image_transform GLEW_GET_VAR(__GLEW_HP_image_transform)
+
+#endif /* GL_HP_image_transform */
+
+/* -------------------------- GL_HP_occlusion_test ------------------------- */
+
+#ifndef GL_HP_occlusion_test
+#define GL_HP_occlusion_test 1
+
+#define GL_OCCLUSION_TEST_HP 0x8165
+#define GL_OCCLUSION_TEST_RESULT_HP 0x8166
+
+#define GLEW_HP_occlusion_test GLEW_GET_VAR(__GLEW_HP_occlusion_test)
+
+#endif /* GL_HP_occlusion_test */
+
+/* ------------------------- GL_HP_texture_lighting ------------------------ */
+
+#ifndef GL_HP_texture_lighting
+#define GL_HP_texture_lighting 1
+
+#define GLEW_HP_texture_lighting GLEW_GET_VAR(__GLEW_HP_texture_lighting)
+
+#endif /* GL_HP_texture_lighting */
+
+/* --------------------------- GL_IBM_cull_vertex -------------------------- */
+
+#ifndef GL_IBM_cull_vertex
+#define GL_IBM_cull_vertex 1
+
+#define GL_CULL_VERTEX_IBM 103050
+
+#define GLEW_IBM_cull_vertex GLEW_GET_VAR(__GLEW_IBM_cull_vertex)
+
+#endif /* GL_IBM_cull_vertex */
+
+/* ---------------------- GL_IBM_multimode_draw_arrays --------------------- */
+
+#ifndef GL_IBM_multimode_draw_arrays
+#define GL_IBM_multimode_draw_arrays 1
+
+typedef void (GLAPIENTRY * PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum* mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride);
+typedef void (GLAPIENTRY * PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum* mode, const GLsizei *count, GLenum type, const GLvoid * const *indices, GLsizei primcount, GLint modestride);
+
+#define glMultiModeDrawArraysIBM GLEW_GET_FUN(__glewMultiModeDrawArraysIBM)
+#define glMultiModeDrawElementsIBM GLEW_GET_FUN(__glewMultiModeDrawElementsIBM)
+
+#define GLEW_IBM_multimode_draw_arrays GLEW_GET_VAR(__GLEW_IBM_multimode_draw_arrays)
+
+#endif /* GL_IBM_multimode_draw_arrays */
+
+/* ------------------------- GL_IBM_rasterpos_clip ------------------------- */
+
+#ifndef GL_IBM_rasterpos_clip
+#define GL_IBM_rasterpos_clip 1
+
+#define GL_RASTER_POSITION_UNCLIPPED_IBM 103010
+
+#define GLEW_IBM_rasterpos_clip GLEW_GET_VAR(__GLEW_IBM_rasterpos_clip)
+
+#endif /* GL_IBM_rasterpos_clip */
+
+/* --------------------------- GL_IBM_static_data -------------------------- */
+
+#ifndef GL_IBM_static_data
+#define GL_IBM_static_data 1
+
+#define GL_ALL_STATIC_DATA_IBM 103060
+#define GL_STATIC_VERTEX_ARRAY_IBM 103061
+
+#define GLEW_IBM_static_data GLEW_GET_VAR(__GLEW_IBM_static_data)
+
+#endif /* GL_IBM_static_data */
+
+/* --------------------- GL_IBM_texture_mirrored_repeat -------------------- */
+
+#ifndef GL_IBM_texture_mirrored_repeat
+#define GL_IBM_texture_mirrored_repeat 1
+
+#define GL_MIRRORED_REPEAT_IBM 0x8370
+
+#define GLEW_IBM_texture_mirrored_repeat GLEW_GET_VAR(__GLEW_IBM_texture_mirrored_repeat)
+
+#endif /* GL_IBM_texture_mirrored_repeat */
+
+/* ----------------------- GL_IBM_vertex_array_lists ----------------------- */
+
+#ifndef GL_IBM_vertex_array_lists
+#define GL_IBM_vertex_array_lists 1
+
+#define GL_VERTEX_ARRAY_LIST_IBM 103070
+#define GL_NORMAL_ARRAY_LIST_IBM 103071
+#define GL_COLOR_ARRAY_LIST_IBM 103072
+#define GL_INDEX_ARRAY_LIST_IBM 103073
+#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074
+#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075
+#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076
+#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077
+#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080
+#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081
+#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082
+#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083
+#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084
+#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085
+#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086
+#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087
+
+typedef void (GLAPIENTRY * PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+typedef void (GLAPIENTRY * PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid ** pointer, GLint ptrstride);
+
+#define glColorPointerListIBM GLEW_GET_FUN(__glewColorPointerListIBM)
+#define glEdgeFlagPointerListIBM GLEW_GET_FUN(__glewEdgeFlagPointerListIBM)
+#define glFogCoordPointerListIBM GLEW_GET_FUN(__glewFogCoordPointerListIBM)
+#define glIndexPointerListIBM GLEW_GET_FUN(__glewIndexPointerListIBM)
+#define glNormalPointerListIBM GLEW_GET_FUN(__glewNormalPointerListIBM)
+#define glSecondaryColorPointerListIBM GLEW_GET_FUN(__glewSecondaryColorPointerListIBM)
+#define glTexCoordPointerListIBM GLEW_GET_FUN(__glewTexCoordPointerListIBM)
+#define glVertexPointerListIBM GLEW_GET_FUN(__glewVertexPointerListIBM)
+
+#define GLEW_IBM_vertex_array_lists GLEW_GET_VAR(__GLEW_IBM_vertex_array_lists)
+
+#endif /* GL_IBM_vertex_array_lists */
+
+/* -------------------------- GL_INGR_color_clamp -------------------------- */
+
+#ifndef GL_INGR_color_clamp
+#define GL_INGR_color_clamp 1
+
+#define GL_RED_MIN_CLAMP_INGR 0x8560
+#define GL_GREEN_MIN_CLAMP_INGR 0x8561
+#define GL_BLUE_MIN_CLAMP_INGR 0x8562
+#define GL_ALPHA_MIN_CLAMP_INGR 0x8563
+#define GL_RED_MAX_CLAMP_INGR 0x8564
+#define GL_GREEN_MAX_CLAMP_INGR 0x8565
+#define GL_BLUE_MAX_CLAMP_INGR 0x8566
+#define GL_ALPHA_MAX_CLAMP_INGR 0x8567
+
+#define GLEW_INGR_color_clamp GLEW_GET_VAR(__GLEW_INGR_color_clamp)
+
+#endif /* GL_INGR_color_clamp */
+
+/* ------------------------- GL_INGR_interlace_read ------------------------ */
+
+#ifndef GL_INGR_interlace_read
+#define GL_INGR_interlace_read 1
+
+#define GL_INTERLACE_READ_INGR 0x8568
+
+#define GLEW_INGR_interlace_read GLEW_GET_VAR(__GLEW_INGR_interlace_read)
+
+#endif /* GL_INGR_interlace_read */
+
+/* ------------------------ GL_INTEL_parallel_arrays ----------------------- */
+
+#ifndef GL_INTEL_parallel_arrays
+#define GL_INTEL_parallel_arrays 1
+
+#define GL_PARALLEL_ARRAYS_INTEL 0x83F4
+#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5
+#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6
+#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7
+#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8
+
+typedef void (GLAPIENTRY * PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const void** pointer);
+typedef void (GLAPIENTRY * PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const void** pointer);
+typedef void (GLAPIENTRY * PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const void** pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const void** pointer);
+
+#define glColorPointervINTEL GLEW_GET_FUN(__glewColorPointervINTEL)
+#define glNormalPointervINTEL GLEW_GET_FUN(__glewNormalPointervINTEL)
+#define glTexCoordPointervINTEL GLEW_GET_FUN(__glewTexCoordPointervINTEL)
+#define glVertexPointervINTEL GLEW_GET_FUN(__glewVertexPointervINTEL)
+
+#define GLEW_INTEL_parallel_arrays GLEW_GET_VAR(__GLEW_INTEL_parallel_arrays)
+
+#endif /* GL_INTEL_parallel_arrays */
+
+/* ------------------------ GL_INTEL_texture_scissor ----------------------- */
+
+#ifndef GL_INTEL_texture_scissor
+#define GL_INTEL_texture_scissor 1
+
+typedef void (GLAPIENTRY * PFNGLTEXSCISSORFUNCINTELPROC) (GLenum target, GLenum lfunc, GLenum hfunc);
+typedef void (GLAPIENTRY * PFNGLTEXSCISSORINTELPROC) (GLenum target, GLclampf tlow, GLclampf thigh);
+
+#define glTexScissorFuncINTEL GLEW_GET_FUN(__glewTexScissorFuncINTEL)
+#define glTexScissorINTEL GLEW_GET_FUN(__glewTexScissorINTEL)
+
+#define GLEW_INTEL_texture_scissor GLEW_GET_VAR(__GLEW_INTEL_texture_scissor)
+
+#endif /* GL_INTEL_texture_scissor */
+
+/* -------------------------- GL_KTX_buffer_region ------------------------- */
+
+#ifndef GL_KTX_buffer_region
+#define GL_KTX_buffer_region 1
+
+#define GL_KTX_FRONT_REGION 0x0
+#define GL_KTX_BACK_REGION 0x1
+#define GL_KTX_Z_REGION 0x2
+#define GL_KTX_STENCIL_REGION 0x3
+
+typedef GLuint (GLAPIENTRY * PFNGLBUFFERREGIONENABLEDEXTPROC) (void);
+typedef void (GLAPIENTRY * PFNGLDELETEBUFFERREGIONEXTPROC) (GLenum region);
+typedef void (GLAPIENTRY * PFNGLDRAWBUFFERREGIONEXTPROC) (GLuint region, GLint x, GLint y, GLsizei width, GLsizei height, GLint xDest, GLint yDest);
+typedef GLuint (GLAPIENTRY * PFNGLNEWBUFFERREGIONEXTPROC) (GLenum region);
+typedef void (GLAPIENTRY * PFNGLREADBUFFERREGIONEXTPROC) (GLuint region, GLint x, GLint y, GLsizei width, GLsizei height);
+
+#define glBufferRegionEnabledEXT GLEW_GET_FUN(__glewBufferRegionEnabledEXT)
+#define glDeleteBufferRegionEXT GLEW_GET_FUN(__glewDeleteBufferRegionEXT)
+#define glDrawBufferRegionEXT GLEW_GET_FUN(__glewDrawBufferRegionEXT)
+#define glNewBufferRegionEXT GLEW_GET_FUN(__glewNewBufferRegionEXT)
+#define glReadBufferRegionEXT GLEW_GET_FUN(__glewReadBufferRegionEXT)
+
+#define GLEW_KTX_buffer_region GLEW_GET_VAR(__GLEW_KTX_buffer_region)
+
+#endif /* GL_KTX_buffer_region */
+
+/* ------------------------- GL_MESAX_texture_stack ------------------------ */
+
+#ifndef GL_MESAX_texture_stack
+#define GL_MESAX_texture_stack 1
+
+#define GL_TEXTURE_1D_STACK_MESAX 0x8759
+#define GL_TEXTURE_2D_STACK_MESAX 0x875A
+#define GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B
+#define GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C
+#define GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D
+#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E
+
+#define GLEW_MESAX_texture_stack GLEW_GET_VAR(__GLEW_MESAX_texture_stack)
+
+#endif /* GL_MESAX_texture_stack */
+
+/* -------------------------- GL_MESA_pack_invert -------------------------- */
+
+#ifndef GL_MESA_pack_invert
+#define GL_MESA_pack_invert 1
+
+#define GL_PACK_INVERT_MESA 0x8758
+
+#define GLEW_MESA_pack_invert GLEW_GET_VAR(__GLEW_MESA_pack_invert)
+
+#endif /* GL_MESA_pack_invert */
+
+/* ------------------------- GL_MESA_resize_buffers ------------------------ */
+
+#ifndef GL_MESA_resize_buffers
+#define GL_MESA_resize_buffers 1
+
+typedef void (GLAPIENTRY * PFNGLRESIZEBUFFERSMESAPROC) (void);
+
+#define glResizeBuffersMESA GLEW_GET_FUN(__glewResizeBuffersMESA)
+
+#define GLEW_MESA_resize_buffers GLEW_GET_VAR(__GLEW_MESA_resize_buffers)
+
+#endif /* GL_MESA_resize_buffers */
+
+/* --------------------------- GL_MESA_window_pos -------------------------- */
+
+#ifndef GL_MESA_window_pos
+#define GL_MESA_window_pos 1
+
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2IVMESAPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS2SVMESAPROC) (const GLshort* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3IVMESAPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS3SVMESAPROC) (const GLshort* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4IVMESAPROC) (const GLint* p);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLWINDOWPOS4SVMESAPROC) (const GLshort* p);
+
+#define glWindowPos2dMESA GLEW_GET_FUN(__glewWindowPos2dMESA)
+#define glWindowPos2dvMESA GLEW_GET_FUN(__glewWindowPos2dvMESA)
+#define glWindowPos2fMESA GLEW_GET_FUN(__glewWindowPos2fMESA)
+#define glWindowPos2fvMESA GLEW_GET_FUN(__glewWindowPos2fvMESA)
+#define glWindowPos2iMESA GLEW_GET_FUN(__glewWindowPos2iMESA)
+#define glWindowPos2ivMESA GLEW_GET_FUN(__glewWindowPos2ivMESA)
+#define glWindowPos2sMESA GLEW_GET_FUN(__glewWindowPos2sMESA)
+#define glWindowPos2svMESA GLEW_GET_FUN(__glewWindowPos2svMESA)
+#define glWindowPos3dMESA GLEW_GET_FUN(__glewWindowPos3dMESA)
+#define glWindowPos3dvMESA GLEW_GET_FUN(__glewWindowPos3dvMESA)
+#define glWindowPos3fMESA GLEW_GET_FUN(__glewWindowPos3fMESA)
+#define glWindowPos3fvMESA GLEW_GET_FUN(__glewWindowPos3fvMESA)
+#define glWindowPos3iMESA GLEW_GET_FUN(__glewWindowPos3iMESA)
+#define glWindowPos3ivMESA GLEW_GET_FUN(__glewWindowPos3ivMESA)
+#define glWindowPos3sMESA GLEW_GET_FUN(__glewWindowPos3sMESA)
+#define glWindowPos3svMESA GLEW_GET_FUN(__glewWindowPos3svMESA)
+#define glWindowPos4dMESA GLEW_GET_FUN(__glewWindowPos4dMESA)
+#define glWindowPos4dvMESA GLEW_GET_FUN(__glewWindowPos4dvMESA)
+#define glWindowPos4fMESA GLEW_GET_FUN(__glewWindowPos4fMESA)
+#define glWindowPos4fvMESA GLEW_GET_FUN(__glewWindowPos4fvMESA)
+#define glWindowPos4iMESA GLEW_GET_FUN(__glewWindowPos4iMESA)
+#define glWindowPos4ivMESA GLEW_GET_FUN(__glewWindowPos4ivMESA)
+#define glWindowPos4sMESA GLEW_GET_FUN(__glewWindowPos4sMESA)
+#define glWindowPos4svMESA GLEW_GET_FUN(__glewWindowPos4svMESA)
+
+#define GLEW_MESA_window_pos GLEW_GET_VAR(__GLEW_MESA_window_pos)
+
+#endif /* GL_MESA_window_pos */
+
+/* ------------------------- GL_MESA_ycbcr_texture ------------------------- */
+
+#ifndef GL_MESA_ycbcr_texture
+#define GL_MESA_ycbcr_texture 1
+
+#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA
+#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB
+#define GL_YCBCR_MESA 0x8757
+
+#define GLEW_MESA_ycbcr_texture GLEW_GET_VAR(__GLEW_MESA_ycbcr_texture)
+
+#endif /* GL_MESA_ycbcr_texture */
+
+/* --------------------------- GL_NV_blend_square -------------------------- */
+
+#ifndef GL_NV_blend_square
+#define GL_NV_blend_square 1
+
+#define GLEW_NV_blend_square GLEW_GET_VAR(__GLEW_NV_blend_square)
+
+#endif /* GL_NV_blend_square */
+
+/* ----------------------- GL_NV_copy_depth_to_color ----------------------- */
+
+#ifndef GL_NV_copy_depth_to_color
+#define GL_NV_copy_depth_to_color 1
+
+#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E
+#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F
+
+#define GLEW_NV_copy_depth_to_color GLEW_GET_VAR(__GLEW_NV_copy_depth_to_color)
+
+#endif /* GL_NV_copy_depth_to_color */
+
+/* --------------------------- GL_NV_depth_clamp --------------------------- */
+
+#ifndef GL_NV_depth_clamp
+#define GL_NV_depth_clamp 1
+
+#define GL_DEPTH_CLAMP_NV 0x864F
+
+#define GLEW_NV_depth_clamp GLEW_GET_VAR(__GLEW_NV_depth_clamp)
+
+#endif /* GL_NV_depth_clamp */
+
+/* ---------------------------- GL_NV_evaluators --------------------------- */
+
+#ifndef GL_NV_evaluators
+#define GL_NV_evaluators 1
+
+#define GL_EVAL_2D_NV 0x86C0
+#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1
+#define GL_MAP_TESSELLATION_NV 0x86C2
+#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3
+#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4
+#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5
+#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6
+#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7
+#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8
+#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9
+#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA
+#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB
+#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC
+#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD
+#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE
+#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF
+#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0
+#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1
+#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2
+#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3
+#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4
+#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5
+#define GL_MAX_MAP_TESSELLATION_NV 0x86D6
+#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7
+
+typedef void (GLAPIENTRY * PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, void* points);
+typedef void (GLAPIENTRY * PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const void* points);
+typedef void (GLAPIENTRY * PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint* params);
+
+#define glEvalMapsNV GLEW_GET_FUN(__glewEvalMapsNV)
+#define glGetMapAttribParameterfvNV GLEW_GET_FUN(__glewGetMapAttribParameterfvNV)
+#define glGetMapAttribParameterivNV GLEW_GET_FUN(__glewGetMapAttribParameterivNV)
+#define glGetMapControlPointsNV GLEW_GET_FUN(__glewGetMapControlPointsNV)
+#define glGetMapParameterfvNV GLEW_GET_FUN(__glewGetMapParameterfvNV)
+#define glGetMapParameterivNV GLEW_GET_FUN(__glewGetMapParameterivNV)
+#define glMapControlPointsNV GLEW_GET_FUN(__glewMapControlPointsNV)
+#define glMapParameterfvNV GLEW_GET_FUN(__glewMapParameterfvNV)
+#define glMapParameterivNV GLEW_GET_FUN(__glewMapParameterivNV)
+
+#define GLEW_NV_evaluators GLEW_GET_VAR(__GLEW_NV_evaluators)
+
+#endif /* GL_NV_evaluators */
+
+/* ------------------------------ GL_NV_fence ------------------------------ */
+
+#ifndef GL_NV_fence
+#define GL_NV_fence 1
+
+#define GL_ALL_COMPLETED_NV 0x84F2
+#define GL_FENCE_STATUS_NV 0x84F3
+#define GL_FENCE_CONDITION_NV 0x84F4
+
+typedef void (GLAPIENTRY * PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint* fences);
+typedef void (GLAPIENTRY * PFNGLFINISHFENCENVPROC) (GLuint fence);
+typedef void (GLAPIENTRY * PFNGLGENFENCESNVPROC) (GLsizei n, GLuint* fences);
+typedef void (GLAPIENTRY * PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISFENCENVPROC) (GLuint fence);
+typedef void (GLAPIENTRY * PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition);
+typedef GLboolean (GLAPIENTRY * PFNGLTESTFENCENVPROC) (GLuint fence);
+
+#define glDeleteFencesNV GLEW_GET_FUN(__glewDeleteFencesNV)
+#define glFinishFenceNV GLEW_GET_FUN(__glewFinishFenceNV)
+#define glGenFencesNV GLEW_GET_FUN(__glewGenFencesNV)
+#define glGetFenceivNV GLEW_GET_FUN(__glewGetFenceivNV)
+#define glIsFenceNV GLEW_GET_FUN(__glewIsFenceNV)
+#define glSetFenceNV GLEW_GET_FUN(__glewSetFenceNV)
+#define glTestFenceNV GLEW_GET_FUN(__glewTestFenceNV)
+
+#define GLEW_NV_fence GLEW_GET_VAR(__GLEW_NV_fence)
+
+#endif /* GL_NV_fence */
+
+/* --------------------------- GL_NV_float_buffer -------------------------- */
+
+#ifndef GL_NV_float_buffer
+#define GL_NV_float_buffer 1
+
+#define GL_FLOAT_R_NV 0x8880
+#define GL_FLOAT_RG_NV 0x8881
+#define GL_FLOAT_RGB_NV 0x8882
+#define GL_FLOAT_RGBA_NV 0x8883
+#define GL_FLOAT_R16_NV 0x8884
+#define GL_FLOAT_R32_NV 0x8885
+#define GL_FLOAT_RG16_NV 0x8886
+#define GL_FLOAT_RG32_NV 0x8887
+#define GL_FLOAT_RGB16_NV 0x8888
+#define GL_FLOAT_RGB32_NV 0x8889
+#define GL_FLOAT_RGBA16_NV 0x888A
+#define GL_FLOAT_RGBA32_NV 0x888B
+#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C
+#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D
+#define GL_FLOAT_RGBA_MODE_NV 0x888E
+
+#define GLEW_NV_float_buffer GLEW_GET_VAR(__GLEW_NV_float_buffer)
+
+#endif /* GL_NV_float_buffer */
+
+/* --------------------------- GL_NV_fog_distance -------------------------- */
+
+#ifndef GL_NV_fog_distance
+#define GL_NV_fog_distance 1
+
+#define GL_FOG_DISTANCE_MODE_NV 0x855A
+#define GL_EYE_RADIAL_NV 0x855B
+#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C
+
+#define GLEW_NV_fog_distance GLEW_GET_VAR(__GLEW_NV_fog_distance)
+
+#endif /* GL_NV_fog_distance */
+
+/* ------------------------- GL_NV_fragment_program ------------------------ */
+
+#ifndef GL_NV_fragment_program
+#define GL_NV_fragment_program 1
+
+#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
+#define GL_FRAGMENT_PROGRAM_NV 0x8870
+#define GL_MAX_TEXTURE_COORDS_NV 0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872
+#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873
+#define GL_PROGRAM_ERROR_STRING_NV 0x8874
+
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte* name, GLdouble *params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte* name, GLfloat *params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte* name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte* name, const GLdouble v[]);
+typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte* name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte* name, const GLfloat v[]);
+
+#define glGetProgramNamedParameterdvNV GLEW_GET_FUN(__glewGetProgramNamedParameterdvNV)
+#define glGetProgramNamedParameterfvNV GLEW_GET_FUN(__glewGetProgramNamedParameterfvNV)
+#define glProgramNamedParameter4dNV GLEW_GET_FUN(__glewProgramNamedParameter4dNV)
+#define glProgramNamedParameter4dvNV GLEW_GET_FUN(__glewProgramNamedParameter4dvNV)
+#define glProgramNamedParameter4fNV GLEW_GET_FUN(__glewProgramNamedParameter4fNV)
+#define glProgramNamedParameter4fvNV GLEW_GET_FUN(__glewProgramNamedParameter4fvNV)
+
+#define GLEW_NV_fragment_program GLEW_GET_VAR(__GLEW_NV_fragment_program)
+
+#endif /* GL_NV_fragment_program */
+
+/* ------------------------ GL_NV_fragment_program2 ------------------------ */
+
+#ifndef GL_NV_fragment_program2
+#define GL_NV_fragment_program2 1
+
+#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4
+#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5
+#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6
+#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7
+#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8
+
+#define GLEW_NV_fragment_program2 GLEW_GET_VAR(__GLEW_NV_fragment_program2)
+
+#endif /* GL_NV_fragment_program2 */
+
+/* --------------------- GL_NV_fragment_program_option --------------------- */
+
+#ifndef GL_NV_fragment_program_option
+#define GL_NV_fragment_program_option 1
+
+#define GLEW_NV_fragment_program_option GLEW_GET_VAR(__GLEW_NV_fragment_program_option)
+
+#endif /* GL_NV_fragment_program_option */
+
+/* ---------------------------- GL_NV_half_float --------------------------- */
+
+#ifndef GL_NV_half_float
+#define GL_NV_half_float 1
+
+#define GL_HALF_FLOAT_NV 0x140B
+
+typedef unsigned short GLhalf;
+
+typedef void (GLAPIENTRY * PFNGLCOLOR3HNVPROC) (GLhalf red, GLhalf green, GLhalf blue);
+typedef void (GLAPIENTRY * PFNGLCOLOR3HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLCOLOR4HNVPROC) (GLhalf red, GLhalf green, GLhalf blue, GLhalf alpha);
+typedef void (GLAPIENTRY * PFNGLCOLOR4HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDHNVPROC) (GLhalf fog);
+typedef void (GLAPIENTRY * PFNGLFOGCOORDHVNVPROC) (const GLhalf* fog);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalf s);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalf s, GLhalf t);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalf s, GLhalf t, GLhalf r);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+typedef void (GLAPIENTRY * PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLNORMAL3HNVPROC) (GLhalf nx, GLhalf ny, GLhalf nz);
+typedef void (GLAPIENTRY * PFNGLNORMAL3HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3HNVPROC) (GLhalf red, GLhalf green, GLhalf blue);
+typedef void (GLAPIENTRY * PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD1HNVPROC) (GLhalf s);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD1HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD2HNVPROC) (GLhalf s, GLhalf t);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD2HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD3HNVPROC) (GLhalf s, GLhalf t, GLhalf r);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD3HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD4HNVPROC) (GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+typedef void (GLAPIENTRY * PFNGLTEXCOORD4HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEX2HNVPROC) (GLhalf x, GLhalf y);
+typedef void (GLAPIENTRY * PFNGLVERTEX2HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEX3HNVPROC) (GLhalf x, GLhalf y, GLhalf z);
+typedef void (GLAPIENTRY * PFNGLVERTEX3HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEX4HNVPROC) (GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+typedef void (GLAPIENTRY * PFNGLVERTEX4HVNVPROC) (const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalf x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalf x, GLhalf y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalf x, GLhalf y, GLhalf z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalf* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTHNVPROC) (GLhalf weight);
+typedef void (GLAPIENTRY * PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalf* weight);
+
+#define glColor3hNV GLEW_GET_FUN(__glewColor3hNV)
+#define glColor3hvNV GLEW_GET_FUN(__glewColor3hvNV)
+#define glColor4hNV GLEW_GET_FUN(__glewColor4hNV)
+#define glColor4hvNV GLEW_GET_FUN(__glewColor4hvNV)
+#define glFogCoordhNV GLEW_GET_FUN(__glewFogCoordhNV)
+#define glFogCoordhvNV GLEW_GET_FUN(__glewFogCoordhvNV)
+#define glMultiTexCoord1hNV GLEW_GET_FUN(__glewMultiTexCoord1hNV)
+#define glMultiTexCoord1hvNV GLEW_GET_FUN(__glewMultiTexCoord1hvNV)
+#define glMultiTexCoord2hNV GLEW_GET_FUN(__glewMultiTexCoord2hNV)
+#define glMultiTexCoord2hvNV GLEW_GET_FUN(__glewMultiTexCoord2hvNV)
+#define glMultiTexCoord3hNV GLEW_GET_FUN(__glewMultiTexCoord3hNV)
+#define glMultiTexCoord3hvNV GLEW_GET_FUN(__glewMultiTexCoord3hvNV)
+#define glMultiTexCoord4hNV GLEW_GET_FUN(__glewMultiTexCoord4hNV)
+#define glMultiTexCoord4hvNV GLEW_GET_FUN(__glewMultiTexCoord4hvNV)
+#define glNormal3hNV GLEW_GET_FUN(__glewNormal3hNV)
+#define glNormal3hvNV GLEW_GET_FUN(__glewNormal3hvNV)
+#define glSecondaryColor3hNV GLEW_GET_FUN(__glewSecondaryColor3hNV)
+#define glSecondaryColor3hvNV GLEW_GET_FUN(__glewSecondaryColor3hvNV)
+#define glTexCoord1hNV GLEW_GET_FUN(__glewTexCoord1hNV)
+#define glTexCoord1hvNV GLEW_GET_FUN(__glewTexCoord1hvNV)
+#define glTexCoord2hNV GLEW_GET_FUN(__glewTexCoord2hNV)
+#define glTexCoord2hvNV GLEW_GET_FUN(__glewTexCoord2hvNV)
+#define glTexCoord3hNV GLEW_GET_FUN(__glewTexCoord3hNV)
+#define glTexCoord3hvNV GLEW_GET_FUN(__glewTexCoord3hvNV)
+#define glTexCoord4hNV GLEW_GET_FUN(__glewTexCoord4hNV)
+#define glTexCoord4hvNV GLEW_GET_FUN(__glewTexCoord4hvNV)
+#define glVertex2hNV GLEW_GET_FUN(__glewVertex2hNV)
+#define glVertex2hvNV GLEW_GET_FUN(__glewVertex2hvNV)
+#define glVertex3hNV GLEW_GET_FUN(__glewVertex3hNV)
+#define glVertex3hvNV GLEW_GET_FUN(__glewVertex3hvNV)
+#define glVertex4hNV GLEW_GET_FUN(__glewVertex4hNV)
+#define glVertex4hvNV GLEW_GET_FUN(__glewVertex4hvNV)
+#define glVertexAttrib1hNV GLEW_GET_FUN(__glewVertexAttrib1hNV)
+#define glVertexAttrib1hvNV GLEW_GET_FUN(__glewVertexAttrib1hvNV)
+#define glVertexAttrib2hNV GLEW_GET_FUN(__glewVertexAttrib2hNV)
+#define glVertexAttrib2hvNV GLEW_GET_FUN(__glewVertexAttrib2hvNV)
+#define glVertexAttrib3hNV GLEW_GET_FUN(__glewVertexAttrib3hNV)
+#define glVertexAttrib3hvNV GLEW_GET_FUN(__glewVertexAttrib3hvNV)
+#define glVertexAttrib4hNV GLEW_GET_FUN(__glewVertexAttrib4hNV)
+#define glVertexAttrib4hvNV GLEW_GET_FUN(__glewVertexAttrib4hvNV)
+#define glVertexAttribs1hvNV GLEW_GET_FUN(__glewVertexAttribs1hvNV)
+#define glVertexAttribs2hvNV GLEW_GET_FUN(__glewVertexAttribs2hvNV)
+#define glVertexAttribs3hvNV GLEW_GET_FUN(__glewVertexAttribs3hvNV)
+#define glVertexAttribs4hvNV GLEW_GET_FUN(__glewVertexAttribs4hvNV)
+#define glVertexWeighthNV GLEW_GET_FUN(__glewVertexWeighthNV)
+#define glVertexWeighthvNV GLEW_GET_FUN(__glewVertexWeighthvNV)
+
+#define GLEW_NV_half_float GLEW_GET_VAR(__GLEW_NV_half_float)
+
+#endif /* GL_NV_half_float */
+
+/* ------------------------ GL_NV_light_max_exponent ----------------------- */
+
+#ifndef GL_NV_light_max_exponent
+#define GL_NV_light_max_exponent 1
+
+#define GL_MAX_SHININESS_NV 0x8504
+#define GL_MAX_SPOT_EXPONENT_NV 0x8505
+
+#define GLEW_NV_light_max_exponent GLEW_GET_VAR(__GLEW_NV_light_max_exponent)
+
+#endif /* GL_NV_light_max_exponent */
+
+/* --------------------- GL_NV_multisample_filter_hint --------------------- */
+
+#ifndef GL_NV_multisample_filter_hint
+#define GL_NV_multisample_filter_hint 1
+
+#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534
+
+#define GLEW_NV_multisample_filter_hint GLEW_GET_VAR(__GLEW_NV_multisample_filter_hint)
+
+#endif /* GL_NV_multisample_filter_hint */
+
+/* ------------------------- GL_NV_occlusion_query ------------------------- */
+
+#ifndef GL_NV_occlusion_query
+#define GL_NV_occlusion_query 1
+
+#define GL_PIXEL_COUNTER_BITS_NV 0x8864
+#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865
+#define GL_PIXEL_COUNT_NV 0x8866
+#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867
+
+typedef void (GLAPIENTRY * PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLENDOCCLUSIONQUERYNVPROC) (void);
+typedef void (GLAPIENTRY * PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id);
+
+#define glBeginOcclusionQueryNV GLEW_GET_FUN(__glewBeginOcclusionQueryNV)
+#define glDeleteOcclusionQueriesNV GLEW_GET_FUN(__glewDeleteOcclusionQueriesNV)
+#define glEndOcclusionQueryNV GLEW_GET_FUN(__glewEndOcclusionQueryNV)
+#define glGenOcclusionQueriesNV GLEW_GET_FUN(__glewGenOcclusionQueriesNV)
+#define glGetOcclusionQueryivNV GLEW_GET_FUN(__glewGetOcclusionQueryivNV)
+#define glGetOcclusionQueryuivNV GLEW_GET_FUN(__glewGetOcclusionQueryuivNV)
+#define glIsOcclusionQueryNV GLEW_GET_FUN(__glewIsOcclusionQueryNV)
+
+#define GLEW_NV_occlusion_query GLEW_GET_VAR(__GLEW_NV_occlusion_query)
+
+#endif /* GL_NV_occlusion_query */
+
+/* ----------------------- GL_NV_packed_depth_stencil ---------------------- */
+
+#ifndef GL_NV_packed_depth_stencil
+#define GL_NV_packed_depth_stencil 1
+
+#define GL_DEPTH_STENCIL_NV 0x84F9
+#define GL_UNSIGNED_INT_24_8_NV 0x84FA
+
+#define GLEW_NV_packed_depth_stencil GLEW_GET_VAR(__GLEW_NV_packed_depth_stencil)
+
+#endif /* GL_NV_packed_depth_stencil */
+
+/* ------------------------- GL_NV_pixel_data_range ------------------------ */
+
+#ifndef GL_NV_pixel_data_range
+#define GL_NV_pixel_data_range 1
+
+#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878
+#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879
+#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A
+#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B
+#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C
+#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D
+
+typedef void (GLAPIENTRY * PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target);
+typedef void (GLAPIENTRY * PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, void* pointer);
+
+#define glFlushPixelDataRangeNV GLEW_GET_FUN(__glewFlushPixelDataRangeNV)
+#define glPixelDataRangeNV GLEW_GET_FUN(__glewPixelDataRangeNV)
+
+#define GLEW_NV_pixel_data_range GLEW_GET_VAR(__GLEW_NV_pixel_data_range)
+
+#endif /* GL_NV_pixel_data_range */
+
+/* --------------------------- GL_NV_point_sprite -------------------------- */
+
+#ifndef GL_NV_point_sprite
+#define GL_NV_point_sprite 1
+
+#define GL_POINT_SPRITE_NV 0x8861
+#define GL_COORD_REPLACE_NV 0x8862
+#define GL_POINT_SPRITE_R_MODE_NV 0x8863
+
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint* params);
+
+#define glPointParameteriNV GLEW_GET_FUN(__glewPointParameteriNV)
+#define glPointParameterivNV GLEW_GET_FUN(__glewPointParameterivNV)
+
+#define GLEW_NV_point_sprite GLEW_GET_VAR(__GLEW_NV_point_sprite)
+
+#endif /* GL_NV_point_sprite */
+
+/* ------------------------ GL_NV_primitive_restart ------------------------ */
+
+#ifndef GL_NV_primitive_restart
+#define GL_NV_primitive_restart 1
+
+#define GL_PRIMITIVE_RESTART_NV 0x8558
+#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559
+
+typedef void (GLAPIENTRY * PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index);
+typedef void (GLAPIENTRY * PFNGLPRIMITIVERESTARTNVPROC) (void);
+
+#define glPrimitiveRestartIndexNV GLEW_GET_FUN(__glewPrimitiveRestartIndexNV)
+#define glPrimitiveRestartNV GLEW_GET_FUN(__glewPrimitiveRestartNV)
+
+#define GLEW_NV_primitive_restart GLEW_GET_VAR(__GLEW_NV_primitive_restart)
+
+#endif /* GL_NV_primitive_restart */
+
+/* ------------------------ GL_NV_register_combiners ----------------------- */
+
+#ifndef GL_NV_register_combiners
+#define GL_NV_register_combiners 1
+
+#define GL_REGISTER_COMBINERS_NV 0x8522
+#define GL_VARIABLE_A_NV 0x8523
+#define GL_VARIABLE_B_NV 0x8524
+#define GL_VARIABLE_C_NV 0x8525
+#define GL_VARIABLE_D_NV 0x8526
+#define GL_VARIABLE_E_NV 0x8527
+#define GL_VARIABLE_F_NV 0x8528
+#define GL_VARIABLE_G_NV 0x8529
+#define GL_CONSTANT_COLOR0_NV 0x852A
+#define GL_CONSTANT_COLOR1_NV 0x852B
+#define GL_PRIMARY_COLOR_NV 0x852C
+#define GL_SECONDARY_COLOR_NV 0x852D
+#define GL_SPARE0_NV 0x852E
+#define GL_SPARE1_NV 0x852F
+#define GL_DISCARD_NV 0x8530
+#define GL_E_TIMES_F_NV 0x8531
+#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532
+#define GL_UNSIGNED_IDENTITY_NV 0x8536
+#define GL_UNSIGNED_INVERT_NV 0x8537
+#define GL_EXPAND_NORMAL_NV 0x8538
+#define GL_EXPAND_NEGATE_NV 0x8539
+#define GL_HALF_BIAS_NORMAL_NV 0x853A
+#define GL_HALF_BIAS_NEGATE_NV 0x853B
+#define GL_SIGNED_IDENTITY_NV 0x853C
+#define GL_SIGNED_NEGATE_NV 0x853D
+#define GL_SCALE_BY_TWO_NV 0x853E
+#define GL_SCALE_BY_FOUR_NV 0x853F
+#define GL_SCALE_BY_ONE_HALF_NV 0x8540
+#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541
+#define GL_COMBINER_INPUT_NV 0x8542
+#define GL_COMBINER_MAPPING_NV 0x8543
+#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544
+#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545
+#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546
+#define GL_COMBINER_MUX_SUM_NV 0x8547
+#define GL_COMBINER_SCALE_NV 0x8548
+#define GL_COMBINER_BIAS_NV 0x8549
+#define GL_COMBINER_AB_OUTPUT_NV 0x854A
+#define GL_COMBINER_CD_OUTPUT_NV 0x854B
+#define GL_COMBINER_SUM_OUTPUT_NV 0x854C
+#define GL_MAX_GENERAL_COMBINERS_NV 0x854D
+#define GL_NUM_GENERAL_COMBINERS_NV 0x854E
+#define GL_COLOR_SUM_CLAMP_NV 0x854F
+#define GL_COMBINER0_NV 0x8550
+#define GL_COMBINER1_NV 0x8551
+#define GL_COMBINER2_NV 0x8552
+#define GL_COMBINER3_NV 0x8553
+#define GL_COMBINER4_NV 0x8554
+#define GL_COMBINER5_NV 0x8555
+#define GL_COMBINER6_NV 0x8556
+#define GL_COMBINER7_NV 0x8557
+
+typedef void (GLAPIENTRY * PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (GLAPIENTRY * PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
+typedef void (GLAPIENTRY * PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+typedef void (GLAPIENTRY * PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint* params);
+
+#define glCombinerInputNV GLEW_GET_FUN(__glewCombinerInputNV)
+#define glCombinerOutputNV GLEW_GET_FUN(__glewCombinerOutputNV)
+#define glCombinerParameterfNV GLEW_GET_FUN(__glewCombinerParameterfNV)
+#define glCombinerParameterfvNV GLEW_GET_FUN(__glewCombinerParameterfvNV)
+#define glCombinerParameteriNV GLEW_GET_FUN(__glewCombinerParameteriNV)
+#define glCombinerParameterivNV GLEW_GET_FUN(__glewCombinerParameterivNV)
+#define glFinalCombinerInputNV GLEW_GET_FUN(__glewFinalCombinerInputNV)
+#define glGetCombinerInputParameterfvNV GLEW_GET_FUN(__glewGetCombinerInputParameterfvNV)
+#define glGetCombinerInputParameterivNV GLEW_GET_FUN(__glewGetCombinerInputParameterivNV)
+#define glGetCombinerOutputParameterfvNV GLEW_GET_FUN(__glewGetCombinerOutputParameterfvNV)
+#define glGetCombinerOutputParameterivNV GLEW_GET_FUN(__glewGetCombinerOutputParameterivNV)
+#define glGetFinalCombinerInputParameterfvNV GLEW_GET_FUN(__glewGetFinalCombinerInputParameterfvNV)
+#define glGetFinalCombinerInputParameterivNV GLEW_GET_FUN(__glewGetFinalCombinerInputParameterivNV)
+
+#define GLEW_NV_register_combiners GLEW_GET_VAR(__GLEW_NV_register_combiners)
+
+#endif /* GL_NV_register_combiners */
+
+/* ----------------------- GL_NV_register_combiners2 ----------------------- */
+
+#ifndef GL_NV_register_combiners2
+#define GL_NV_register_combiners2 1
+
+#define GL_PER_STAGE_CONSTANTS_NV 0x8535
+
+typedef void (GLAPIENTRY * PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat* params);
+
+#define glCombinerStageParameterfvNV GLEW_GET_FUN(__glewCombinerStageParameterfvNV)
+#define glGetCombinerStageParameterfvNV GLEW_GET_FUN(__glewGetCombinerStageParameterfvNV)
+
+#define GLEW_NV_register_combiners2 GLEW_GET_VAR(__GLEW_NV_register_combiners2)
+
+#endif /* GL_NV_register_combiners2 */
+
+/* -------------------------- GL_NV_texgen_emboss -------------------------- */
+
+#ifndef GL_NV_texgen_emboss
+#define GL_NV_texgen_emboss 1
+
+#define GL_EMBOSS_LIGHT_NV 0x855D
+#define GL_EMBOSS_CONSTANT_NV 0x855E
+#define GL_EMBOSS_MAP_NV 0x855F
+
+#define GLEW_NV_texgen_emboss GLEW_GET_VAR(__GLEW_NV_texgen_emboss)
+
+#endif /* GL_NV_texgen_emboss */
+
+/* ------------------------ GL_NV_texgen_reflection ------------------------ */
+
+#ifndef GL_NV_texgen_reflection
+#define GL_NV_texgen_reflection 1
+
+#define GL_NORMAL_MAP_NV 0x8511
+#define GL_REFLECTION_MAP_NV 0x8512
+
+#define GLEW_NV_texgen_reflection GLEW_GET_VAR(__GLEW_NV_texgen_reflection)
+
+#endif /* GL_NV_texgen_reflection */
+
+/* --------------------- GL_NV_texture_compression_vtc --------------------- */
+
+#ifndef GL_NV_texture_compression_vtc
+#define GL_NV_texture_compression_vtc 1
+
+#define GLEW_NV_texture_compression_vtc GLEW_GET_VAR(__GLEW_NV_texture_compression_vtc)
+
+#endif /* GL_NV_texture_compression_vtc */
+
+/* ----------------------- GL_NV_texture_env_combine4 ---------------------- */
+
+#ifndef GL_NV_texture_env_combine4
+#define GL_NV_texture_env_combine4 1
+
+#define GL_COMBINE4_NV 0x8503
+#define GL_SOURCE3_RGB_NV 0x8583
+#define GL_SOURCE3_ALPHA_NV 0x858B
+#define GL_OPERAND3_RGB_NV 0x8593
+#define GL_OPERAND3_ALPHA_NV 0x859B
+
+#define GLEW_NV_texture_env_combine4 GLEW_GET_VAR(__GLEW_NV_texture_env_combine4)
+
+#endif /* GL_NV_texture_env_combine4 */
+
+/* ---------------------- GL_NV_texture_expand_normal ---------------------- */
+
+#ifndef GL_NV_texture_expand_normal
+#define GL_NV_texture_expand_normal 1
+
+#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F
+
+#define GLEW_NV_texture_expand_normal GLEW_GET_VAR(__GLEW_NV_texture_expand_normal)
+
+#endif /* GL_NV_texture_expand_normal */
+
+/* ------------------------ GL_NV_texture_rectangle ------------------------ */
+
+#ifndef GL_NV_texture_rectangle
+#define GL_NV_texture_rectangle 1
+
+#define GL_TEXTURE_RECTANGLE_NV 0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8
+
+#define GLEW_NV_texture_rectangle GLEW_GET_VAR(__GLEW_NV_texture_rectangle)
+
+#endif /* GL_NV_texture_rectangle */
+
+/* -------------------------- GL_NV_texture_shader ------------------------- */
+
+#ifndef GL_NV_texture_shader
+#define GL_NV_texture_shader 1
+
+#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C
+#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D
+#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E
+#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9
+#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA
+#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB
+#define GL_DSDT_MAG_INTENSITY_NV 0x86DC
+#define GL_SHADER_CONSISTENT_NV 0x86DD
+#define GL_TEXTURE_SHADER_NV 0x86DE
+#define GL_SHADER_OPERATION_NV 0x86DF
+#define GL_CULL_MODES_NV 0x86E0
+#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1
+#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2
+#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3
+#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4
+#define GL_CONST_EYE_NV 0x86E5
+#define GL_PASS_THROUGH_NV 0x86E6
+#define GL_CULL_FRAGMENT_NV 0x86E7
+#define GL_OFFSET_TEXTURE_2D_NV 0x86E8
+#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9
+#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA
+#define GL_DOT_PRODUCT_NV 0x86EC
+#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED
+#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE
+#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0
+#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1
+#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2
+#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3
+#define GL_HILO_NV 0x86F4
+#define GL_DSDT_NV 0x86F5
+#define GL_DSDT_MAG_NV 0x86F6
+#define GL_DSDT_MAG_VIB_NV 0x86F7
+#define GL_HILO16_NV 0x86F8
+#define GL_SIGNED_HILO_NV 0x86F9
+#define GL_SIGNED_HILO16_NV 0x86FA
+#define GL_SIGNED_RGBA_NV 0x86FB
+#define GL_SIGNED_RGBA8_NV 0x86FC
+#define GL_SIGNED_RGB_NV 0x86FE
+#define GL_SIGNED_RGB8_NV 0x86FF
+#define GL_SIGNED_LUMINANCE_NV 0x8701
+#define GL_SIGNED_LUMINANCE8_NV 0x8702
+#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703
+#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704
+#define GL_SIGNED_ALPHA_NV 0x8705
+#define GL_SIGNED_ALPHA8_NV 0x8706
+#define GL_SIGNED_INTENSITY_NV 0x8707
+#define GL_SIGNED_INTENSITY8_NV 0x8708
+#define GL_DSDT8_NV 0x8709
+#define GL_DSDT8_MAG8_NV 0x870A
+#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B
+#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C
+#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
+#define GL_HI_SCALE_NV 0x870E
+#define GL_LO_SCALE_NV 0x870F
+#define GL_DS_SCALE_NV 0x8710
+#define GL_DT_SCALE_NV 0x8711
+#define GL_MAGNITUDE_SCALE_NV 0x8712
+#define GL_VIBRANCE_SCALE_NV 0x8713
+#define GL_HI_BIAS_NV 0x8714
+#define GL_LO_BIAS_NV 0x8715
+#define GL_DS_BIAS_NV 0x8716
+#define GL_DT_BIAS_NV 0x8717
+#define GL_MAGNITUDE_BIAS_NV 0x8718
+#define GL_VIBRANCE_BIAS_NV 0x8719
+#define GL_TEXTURE_BORDER_VALUES_NV 0x871A
+#define GL_TEXTURE_HI_SIZE_NV 0x871B
+#define GL_TEXTURE_LO_SIZE_NV 0x871C
+#define GL_TEXTURE_DS_SIZE_NV 0x871D
+#define GL_TEXTURE_DT_SIZE_NV 0x871E
+#define GL_TEXTURE_MAG_SIZE_NV 0x871F
+
+#define GLEW_NV_texture_shader GLEW_GET_VAR(__GLEW_NV_texture_shader)
+
+#endif /* GL_NV_texture_shader */
+
+/* ------------------------- GL_NV_texture_shader2 ------------------------- */
+
+#ifndef GL_NV_texture_shader2
+#define GL_NV_texture_shader2 1
+
+#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA
+#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB
+#define GL_DSDT_MAG_INTENSITY_NV 0x86DC
+#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF
+#define GL_HILO_NV 0x86F4
+#define GL_DSDT_NV 0x86F5
+#define GL_DSDT_MAG_NV 0x86F6
+#define GL_DSDT_MAG_VIB_NV 0x86F7
+#define GL_HILO16_NV 0x86F8
+#define GL_SIGNED_HILO_NV 0x86F9
+#define GL_SIGNED_HILO16_NV 0x86FA
+#define GL_SIGNED_RGBA_NV 0x86FB
+#define GL_SIGNED_RGBA8_NV 0x86FC
+#define GL_SIGNED_RGB_NV 0x86FE
+#define GL_SIGNED_RGB8_NV 0x86FF
+#define GL_SIGNED_LUMINANCE_NV 0x8701
+#define GL_SIGNED_LUMINANCE8_NV 0x8702
+#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703
+#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704
+#define GL_SIGNED_ALPHA_NV 0x8705
+#define GL_SIGNED_ALPHA8_NV 0x8706
+#define GL_SIGNED_INTENSITY_NV 0x8707
+#define GL_SIGNED_INTENSITY8_NV 0x8708
+#define GL_DSDT8_NV 0x8709
+#define GL_DSDT8_MAG8_NV 0x870A
+#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B
+#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C
+#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
+
+#define GLEW_NV_texture_shader2 GLEW_GET_VAR(__GLEW_NV_texture_shader2)
+
+#endif /* GL_NV_texture_shader2 */
+
+/* ------------------------- GL_NV_texture_shader3 ------------------------- */
+
+#ifndef GL_NV_texture_shader3
+#define GL_NV_texture_shader3 1
+
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853
+#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854
+#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857
+#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858
+#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859
+#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A
+#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B
+#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C
+#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D
+#define GL_HILO8_NV 0x885E
+#define GL_SIGNED_HILO8_NV 0x885F
+#define GL_FORCE_BLUE_TO_ONE_NV 0x8860
+
+#define GLEW_NV_texture_shader3 GLEW_GET_VAR(__GLEW_NV_texture_shader3)
+
+#endif /* GL_NV_texture_shader3 */
+
+/* ------------------------ GL_NV_vertex_array_range ----------------------- */
+
+#ifndef GL_NV_vertex_array_range
+#define GL_NV_vertex_array_range 1
+
+#define GL_VERTEX_ARRAY_RANGE_NV 0x851D
+#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E
+#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F
+#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520
+#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521
+
+typedef void (GLAPIENTRY * PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void);
+typedef void (GLAPIENTRY * PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, void* pointer);
+
+#define glFlushVertexArrayRangeNV GLEW_GET_FUN(__glewFlushVertexArrayRangeNV)
+#define glVertexArrayRangeNV GLEW_GET_FUN(__glewVertexArrayRangeNV)
+
+#define GLEW_NV_vertex_array_range GLEW_GET_VAR(__GLEW_NV_vertex_array_range)
+
+#endif /* GL_NV_vertex_array_range */
+
+/* ----------------------- GL_NV_vertex_array_range2 ----------------------- */
+
+#ifndef GL_NV_vertex_array_range2
+#define GL_NV_vertex_array_range2 1
+
+#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533
+
+#define GLEW_NV_vertex_array_range2 GLEW_GET_VAR(__GLEW_NV_vertex_array_range2)
+
+#endif /* GL_NV_vertex_array_range2 */
+
+/* -------------------------- GL_NV_vertex_program ------------------------- */
+
+#ifndef GL_NV_vertex_program
+#define GL_NV_vertex_program 1
+
+#define GL_VERTEX_PROGRAM_NV 0x8620
+#define GL_VERTEX_STATE_PROGRAM_NV 0x8621
+#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623
+#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624
+#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625
+#define GL_CURRENT_ATTRIB_NV 0x8626
+#define GL_PROGRAM_LENGTH_NV 0x8627
+#define GL_PROGRAM_STRING_NV 0x8628
+#define GL_MODELVIEW_PROJECTION_NV 0x8629
+#define GL_IDENTITY_NV 0x862A
+#define GL_INVERSE_NV 0x862B
+#define GL_TRANSPOSE_NV 0x862C
+#define GL_INVERSE_TRANSPOSE_NV 0x862D
+#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E
+#define GL_MAX_TRACK_MATRICES_NV 0x862F
+#define GL_MATRIX0_NV 0x8630
+#define GL_MATRIX1_NV 0x8631
+#define GL_MATRIX2_NV 0x8632
+#define GL_MATRIX3_NV 0x8633
+#define GL_MATRIX4_NV 0x8634
+#define GL_MATRIX5_NV 0x8635
+#define GL_MATRIX6_NV 0x8636
+#define GL_MATRIX7_NV 0x8637
+#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640
+#define GL_CURRENT_MATRIX_NV 0x8641
+#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643
+#define GL_PROGRAM_PARAMETER_NV 0x8644
+#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645
+#define GL_PROGRAM_TARGET_NV 0x8646
+#define GL_PROGRAM_RESIDENT_NV 0x8647
+#define GL_TRACK_MATRIX_NV 0x8648
+#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649
+#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A
+#define GL_PROGRAM_ERROR_POSITION_NV 0x864B
+#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650
+#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651
+#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652
+#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653
+#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654
+#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655
+#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656
+#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657
+#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658
+#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659
+#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A
+#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B
+#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C
+#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D
+#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E
+#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F
+#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660
+#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661
+#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662
+#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663
+#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664
+#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665
+#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666
+#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667
+#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668
+#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669
+#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A
+#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B
+#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C
+#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D
+#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E
+#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F
+#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670
+#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671
+#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672
+#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673
+#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674
+#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675
+#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676
+#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677
+#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678
+#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679
+#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A
+#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B
+#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C
+#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D
+#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E
+#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F
+
+typedef GLboolean (GLAPIENTRY * PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint* ids, GLboolean *residences);
+typedef void (GLAPIENTRY * PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id);
+typedef void (GLAPIENTRY * PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte* program);
+typedef void (GLAPIENTRY * PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid** pointer);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint* params);
+typedef GLboolean (GLAPIENTRY * PFNGLISPROGRAMNVPROC) (GLuint id);
+typedef void (GLAPIENTRY * PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte* program);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint num, const GLdouble* params);
+typedef void (GLAPIENTRY * PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint num, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, GLuint* ids);
+typedef void (GLAPIENTRY * PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const void* pointer);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei n, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei n, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei n, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei n, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei n, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei n, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei n, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei n, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei n, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei n, const GLdouble* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei n, const GLfloat* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei n, const GLshort* v);
+typedef void (GLAPIENTRY * PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei n, const GLubyte* v);
+
+#define glAreProgramsResidentNV GLEW_GET_FUN(__glewAreProgramsResidentNV)
+#define glBindProgramNV GLEW_GET_FUN(__glewBindProgramNV)
+#define glDeleteProgramsNV GLEW_GET_FUN(__glewDeleteProgramsNV)
+#define glExecuteProgramNV GLEW_GET_FUN(__glewExecuteProgramNV)
+#define glGenProgramsNV GLEW_GET_FUN(__glewGenProgramsNV)
+#define glGetProgramParameterdvNV GLEW_GET_FUN(__glewGetProgramParameterdvNV)
+#define glGetProgramParameterfvNV GLEW_GET_FUN(__glewGetProgramParameterfvNV)
+#define glGetProgramStringNV GLEW_GET_FUN(__glewGetProgramStringNV)
+#define glGetProgramivNV GLEW_GET_FUN(__glewGetProgramivNV)
+#define glGetTrackMatrixivNV GLEW_GET_FUN(__glewGetTrackMatrixivNV)
+#define glGetVertexAttribPointervNV GLEW_GET_FUN(__glewGetVertexAttribPointervNV)
+#define glGetVertexAttribdvNV GLEW_GET_FUN(__glewGetVertexAttribdvNV)
+#define glGetVertexAttribfvNV GLEW_GET_FUN(__glewGetVertexAttribfvNV)
+#define glGetVertexAttribivNV GLEW_GET_FUN(__glewGetVertexAttribivNV)
+#define glIsProgramNV GLEW_GET_FUN(__glewIsProgramNV)
+#define glLoadProgramNV GLEW_GET_FUN(__glewLoadProgramNV)
+#define glProgramParameter4dNV GLEW_GET_FUN(__glewProgramParameter4dNV)
+#define glProgramParameter4dvNV GLEW_GET_FUN(__glewProgramParameter4dvNV)
+#define glProgramParameter4fNV GLEW_GET_FUN(__glewProgramParameter4fNV)
+#define glProgramParameter4fvNV GLEW_GET_FUN(__glewProgramParameter4fvNV)
+#define glProgramParameters4dvNV GLEW_GET_FUN(__glewProgramParameters4dvNV)
+#define glProgramParameters4fvNV GLEW_GET_FUN(__glewProgramParameters4fvNV)
+#define glRequestResidentProgramsNV GLEW_GET_FUN(__glewRequestResidentProgramsNV)
+#define glTrackMatrixNV GLEW_GET_FUN(__glewTrackMatrixNV)
+#define glVertexAttrib1dNV GLEW_GET_FUN(__glewVertexAttrib1dNV)
+#define glVertexAttrib1dvNV GLEW_GET_FUN(__glewVertexAttrib1dvNV)
+#define glVertexAttrib1fNV GLEW_GET_FUN(__glewVertexAttrib1fNV)
+#define glVertexAttrib1fvNV GLEW_GET_FUN(__glewVertexAttrib1fvNV)
+#define glVertexAttrib1sNV GLEW_GET_FUN(__glewVertexAttrib1sNV)
+#define glVertexAttrib1svNV GLEW_GET_FUN(__glewVertexAttrib1svNV)
+#define glVertexAttrib2dNV GLEW_GET_FUN(__glewVertexAttrib2dNV)
+#define glVertexAttrib2dvNV GLEW_GET_FUN(__glewVertexAttrib2dvNV)
+#define glVertexAttrib2fNV GLEW_GET_FUN(__glewVertexAttrib2fNV)
+#define glVertexAttrib2fvNV GLEW_GET_FUN(__glewVertexAttrib2fvNV)
+#define glVertexAttrib2sNV GLEW_GET_FUN(__glewVertexAttrib2sNV)
+#define glVertexAttrib2svNV GLEW_GET_FUN(__glewVertexAttrib2svNV)
+#define glVertexAttrib3dNV GLEW_GET_FUN(__glewVertexAttrib3dNV)
+#define glVertexAttrib3dvNV GLEW_GET_FUN(__glewVertexAttrib3dvNV)
+#define glVertexAttrib3fNV GLEW_GET_FUN(__glewVertexAttrib3fNV)
+#define glVertexAttrib3fvNV GLEW_GET_FUN(__glewVertexAttrib3fvNV)
+#define glVertexAttrib3sNV GLEW_GET_FUN(__glewVertexAttrib3sNV)
+#define glVertexAttrib3svNV GLEW_GET_FUN(__glewVertexAttrib3svNV)
+#define glVertexAttrib4dNV GLEW_GET_FUN(__glewVertexAttrib4dNV)
+#define glVertexAttrib4dvNV GLEW_GET_FUN(__glewVertexAttrib4dvNV)
+#define glVertexAttrib4fNV GLEW_GET_FUN(__glewVertexAttrib4fNV)
+#define glVertexAttrib4fvNV GLEW_GET_FUN(__glewVertexAttrib4fvNV)
+#define glVertexAttrib4sNV GLEW_GET_FUN(__glewVertexAttrib4sNV)
+#define glVertexAttrib4svNV GLEW_GET_FUN(__glewVertexAttrib4svNV)
+#define glVertexAttrib4ubNV GLEW_GET_FUN(__glewVertexAttrib4ubNV)
+#define glVertexAttrib4ubvNV GLEW_GET_FUN(__glewVertexAttrib4ubvNV)
+#define glVertexAttribPointerNV GLEW_GET_FUN(__glewVertexAttribPointerNV)
+#define glVertexAttribs1dvNV GLEW_GET_FUN(__glewVertexAttribs1dvNV)
+#define glVertexAttribs1fvNV GLEW_GET_FUN(__glewVertexAttribs1fvNV)
+#define glVertexAttribs1svNV GLEW_GET_FUN(__glewVertexAttribs1svNV)
+#define glVertexAttribs2dvNV GLEW_GET_FUN(__glewVertexAttribs2dvNV)
+#define glVertexAttribs2fvNV GLEW_GET_FUN(__glewVertexAttribs2fvNV)
+#define glVertexAttribs2svNV GLEW_GET_FUN(__glewVertexAttribs2svNV)
+#define glVertexAttribs3dvNV GLEW_GET_FUN(__glewVertexAttribs3dvNV)
+#define glVertexAttribs3fvNV GLEW_GET_FUN(__glewVertexAttribs3fvNV)
+#define glVertexAttribs3svNV GLEW_GET_FUN(__glewVertexAttribs3svNV)
+#define glVertexAttribs4dvNV GLEW_GET_FUN(__glewVertexAttribs4dvNV)
+#define glVertexAttribs4fvNV GLEW_GET_FUN(__glewVertexAttribs4fvNV)
+#define glVertexAttribs4svNV GLEW_GET_FUN(__glewVertexAttribs4svNV)
+#define glVertexAttribs4ubvNV GLEW_GET_FUN(__glewVertexAttribs4ubvNV)
+
+#define GLEW_NV_vertex_program GLEW_GET_VAR(__GLEW_NV_vertex_program)
+
+#endif /* GL_NV_vertex_program */
+
+/* ------------------------ GL_NV_vertex_program1_1 ------------------------ */
+
+#ifndef GL_NV_vertex_program1_1
+#define GL_NV_vertex_program1_1 1
+
+#define GLEW_NV_vertex_program1_1 GLEW_GET_VAR(__GLEW_NV_vertex_program1_1)
+
+#endif /* GL_NV_vertex_program1_1 */
+
+/* ------------------------- GL_NV_vertex_program2 ------------------------- */
+
+#ifndef GL_NV_vertex_program2
+#define GL_NV_vertex_program2 1
+
+#define GLEW_NV_vertex_program2 GLEW_GET_VAR(__GLEW_NV_vertex_program2)
+
+#endif /* GL_NV_vertex_program2 */
+
+/* ---------------------- GL_NV_vertex_program2_option --------------------- */
+
+#ifndef GL_NV_vertex_program2_option
+#define GL_NV_vertex_program2_option 1
+
+#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4
+#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5
+
+#define GLEW_NV_vertex_program2_option GLEW_GET_VAR(__GLEW_NV_vertex_program2_option)
+
+#endif /* GL_NV_vertex_program2_option */
+
+/* ------------------------- GL_NV_vertex_program3 ------------------------- */
+
+#ifndef GL_NV_vertex_program3
+#define GL_NV_vertex_program3 1
+
+#define MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C
+
+#define GLEW_NV_vertex_program3 GLEW_GET_VAR(__GLEW_NV_vertex_program3)
+
+#endif /* GL_NV_vertex_program3 */
+
+/* ---------------------------- GL_OML_interlace --------------------------- */
+
+#ifndef GL_OML_interlace
+#define GL_OML_interlace 1
+
+#define GL_INTERLACE_OML 0x8980
+#define GL_INTERLACE_READ_OML 0x8981
+
+#define GLEW_OML_interlace GLEW_GET_VAR(__GLEW_OML_interlace)
+
+#endif /* GL_OML_interlace */
+
+/* ---------------------------- GL_OML_resample ---------------------------- */
+
+#ifndef GL_OML_resample
+#define GL_OML_resample 1
+
+#define GL_PACK_RESAMPLE_OML 0x8984
+#define GL_UNPACK_RESAMPLE_OML 0x8985
+#define GL_RESAMPLE_REPLICATE_OML 0x8986
+#define GL_RESAMPLE_ZERO_FILL_OML 0x8987
+#define GL_RESAMPLE_AVERAGE_OML 0x8988
+#define GL_RESAMPLE_DECIMATE_OML 0x8989
+
+#define GLEW_OML_resample GLEW_GET_VAR(__GLEW_OML_resample)
+
+#endif /* GL_OML_resample */
+
+/* ---------------------------- GL_OML_subsample --------------------------- */
+
+#ifndef GL_OML_subsample
+#define GL_OML_subsample 1
+
+#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982
+#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983
+
+#define GLEW_OML_subsample GLEW_GET_VAR(__GLEW_OML_subsample)
+
+#endif /* GL_OML_subsample */
+
+/* --------------------------- GL_PGI_misc_hints --------------------------- */
+
+#ifndef GL_PGI_misc_hints
+#define GL_PGI_misc_hints 1
+
+#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 107000
+#define GL_CONSERVE_MEMORY_HINT_PGI 107005
+#define GL_RECLAIM_MEMORY_HINT_PGI 107006
+#define GL_NATIVE_GRAPHICS_HANDLE_PGI 107010
+#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 107011
+#define GL_NATIVE_GRAPHICS_END_HINT_PGI 107012
+#define GL_ALWAYS_FAST_HINT_PGI 107020
+#define GL_ALWAYS_SOFT_HINT_PGI 107021
+#define GL_ALLOW_DRAW_OBJ_HINT_PGI 107022
+#define GL_ALLOW_DRAW_WIN_HINT_PGI 107023
+#define GL_ALLOW_DRAW_FRG_HINT_PGI 107024
+#define GL_ALLOW_DRAW_MEM_HINT_PGI 107025
+#define GL_STRICT_DEPTHFUNC_HINT_PGI 107030
+#define GL_STRICT_LIGHTING_HINT_PGI 107031
+#define GL_STRICT_SCISSOR_HINT_PGI 107032
+#define GL_FULL_STIPPLE_HINT_PGI 107033
+#define GL_CLIP_NEAR_HINT_PGI 107040
+#define GL_CLIP_FAR_HINT_PGI 107041
+#define GL_WIDE_LINE_HINT_PGI 107042
+#define GL_BACK_NORMALS_HINT_PGI 107043
+
+#define GLEW_PGI_misc_hints GLEW_GET_VAR(__GLEW_PGI_misc_hints)
+
+#endif /* GL_PGI_misc_hints */
+
+/* -------------------------- GL_PGI_vertex_hints -------------------------- */
+
+#ifndef GL_PGI_vertex_hints
+#define GL_PGI_vertex_hints 1
+
+#define GL_VERTEX23_BIT_PGI 0x00000004
+#define GL_VERTEX4_BIT_PGI 0x00000008
+#define GL_COLOR3_BIT_PGI 0x00010000
+#define GL_COLOR4_BIT_PGI 0x00020000
+#define GL_EDGEFLAG_BIT_PGI 0x00040000
+#define GL_INDEX_BIT_PGI 0x00080000
+#define GL_MAT_AMBIENT_BIT_PGI 0x00100000
+#define GL_VERTEX_DATA_HINT_PGI 107050
+#define GL_VERTEX_CONSISTENT_HINT_PGI 107051
+#define GL_MATERIAL_SIDE_HINT_PGI 107052
+#define GL_MAX_VERTEX_HINT_PGI 107053
+#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000
+#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000
+#define GL_MAT_EMISSION_BIT_PGI 0x00800000
+#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000
+#define GL_MAT_SHININESS_BIT_PGI 0x02000000
+#define GL_MAT_SPECULAR_BIT_PGI 0x04000000
+#define GL_NORMAL_BIT_PGI 0x08000000
+#define GL_TEXCOORD1_BIT_PGI 0x10000000
+#define GL_TEXCOORD2_BIT_PGI 0x20000000
+#define GL_TEXCOORD3_BIT_PGI 0x40000000
+#define GL_TEXCOORD4_BIT_PGI 0x80000000
+
+#define GLEW_PGI_vertex_hints GLEW_GET_VAR(__GLEW_PGI_vertex_hints)
+
+#endif /* GL_PGI_vertex_hints */
+
+/* ----------------------- GL_REND_screen_coordinates ---------------------- */
+
+#ifndef GL_REND_screen_coordinates
+#define GL_REND_screen_coordinates 1
+
+#define GL_SCREEN_COORDINATES_REND 0x8490
+#define GL_INVERTED_SCREEN_W_REND 0x8491
+
+#define GLEW_REND_screen_coordinates GLEW_GET_VAR(__GLEW_REND_screen_coordinates)
+
+#endif /* GL_REND_screen_coordinates */
+
+/* ------------------------------- GL_S3_s3tc ------------------------------ */
+
+#ifndef GL_S3_s3tc
+#define GL_S3_s3tc 1
+
+#define GL_RGB_S3TC 0x83A0
+#define GL_RGB4_S3TC 0x83A1
+#define GL_RGBA_S3TC 0x83A2
+#define GL_RGBA4_S3TC 0x83A3
+#define GL_RGBA_DXT5_S3TC 0x83A4
+#define GL_RGBA4_DXT5_S3TC 0x83A5
+
+#define GLEW_S3_s3tc GLEW_GET_VAR(__GLEW_S3_s3tc)
+
+#endif /* GL_S3_s3tc */
+
+/* -------------------------- GL_SGIS_color_range -------------------------- */
+
+#ifndef GL_SGIS_color_range
+#define GL_SGIS_color_range 1
+
+#define GL_EXTENDED_RANGE_SGIS 0x85A5
+#define GL_MIN_RED_SGIS 0x85A6
+#define GL_MAX_RED_SGIS 0x85A7
+#define GL_MIN_GREEN_SGIS 0x85A8
+#define GL_MAX_GREEN_SGIS 0x85A9
+#define GL_MIN_BLUE_SGIS 0x85AA
+#define GL_MAX_BLUE_SGIS 0x85AB
+#define GL_MIN_ALPHA_SGIS 0x85AC
+#define GL_MAX_ALPHA_SGIS 0x85AD
+
+#define GLEW_SGIS_color_range GLEW_GET_VAR(__GLEW_SGIS_color_range)
+
+#endif /* GL_SGIS_color_range */
+
+/* ------------------------- GL_SGIS_detail_texture ------------------------ */
+
+#ifndef GL_SGIS_detail_texture
+#define GL_SGIS_detail_texture 1
+
+typedef void (GLAPIENTRY * PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat* points);
+typedef void (GLAPIENTRY * PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat* points);
+
+#define glDetailTexFuncSGIS GLEW_GET_FUN(__glewDetailTexFuncSGIS)
+#define glGetDetailTexFuncSGIS GLEW_GET_FUN(__glewGetDetailTexFuncSGIS)
+
+#define GLEW_SGIS_detail_texture GLEW_GET_VAR(__GLEW_SGIS_detail_texture)
+
+#endif /* GL_SGIS_detail_texture */
+
+/* -------------------------- GL_SGIS_fog_function ------------------------- */
+
+#ifndef GL_SGIS_fog_function
+#define GL_SGIS_fog_function 1
+
+typedef void (GLAPIENTRY * PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat* points);
+typedef void (GLAPIENTRY * PFNGLGETFOGFUNCSGISPROC) (GLfloat* points);
+
+#define glFogFuncSGIS GLEW_GET_FUN(__glewFogFuncSGIS)
+#define glGetFogFuncSGIS GLEW_GET_FUN(__glewGetFogFuncSGIS)
+
+#define GLEW_SGIS_fog_function GLEW_GET_VAR(__GLEW_SGIS_fog_function)
+
+#endif /* GL_SGIS_fog_function */
+
+/* ------------------------ GL_SGIS_generate_mipmap ------------------------ */
+
+#ifndef GL_SGIS_generate_mipmap
+#define GL_SGIS_generate_mipmap 1
+
+#define GL_GENERATE_MIPMAP_SGIS 0x8191
+#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192
+
+#define GLEW_SGIS_generate_mipmap GLEW_GET_VAR(__GLEW_SGIS_generate_mipmap)
+
+#endif /* GL_SGIS_generate_mipmap */
+
+/* -------------------------- GL_SGIS_multisample -------------------------- */
+
+#ifndef GL_SGIS_multisample
+#define GL_SGIS_multisample 1
+
+#define GL_MULTISAMPLE_SGIS 0x809D
+#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F
+#define GL_SAMPLE_MASK_SGIS 0x80A0
+#define GL_1PASS_SGIS 0x80A1
+#define GL_2PASS_0_SGIS 0x80A2
+#define GL_2PASS_1_SGIS 0x80A3
+#define GL_4PASS_0_SGIS 0x80A4
+#define GL_4PASS_1_SGIS 0x80A5
+#define GL_4PASS_2_SGIS 0x80A6
+#define GL_4PASS_3_SGIS 0x80A7
+#define GL_SAMPLE_BUFFERS_SGIS 0x80A8
+#define GL_SAMPLES_SGIS 0x80A9
+#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA
+#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB
+#define GL_SAMPLE_PATTERN_SGIS 0x80AC
+#define GL_MULTISAMPLE_BIT_EXT 0x20000000
+
+typedef void (GLAPIENTRY * PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert);
+typedef void (GLAPIENTRY * PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern);
+
+#define glSampleMaskSGIS GLEW_GET_FUN(__glewSampleMaskSGIS)
+#define glSamplePatternSGIS GLEW_GET_FUN(__glewSamplePatternSGIS)
+
+#define GLEW_SGIS_multisample GLEW_GET_VAR(__GLEW_SGIS_multisample)
+
+#endif /* GL_SGIS_multisample */
+
+/* ------------------------- GL_SGIS_pixel_texture ------------------------- */
+
+#ifndef GL_SGIS_pixel_texture
+#define GL_SGIS_pixel_texture 1
+
+#define GLEW_SGIS_pixel_texture GLEW_GET_VAR(__GLEW_SGIS_pixel_texture)
+
+#endif /* GL_SGIS_pixel_texture */
+
+/* ------------------------ GL_SGIS_sharpen_texture ------------------------ */
+
+#ifndef GL_SGIS_sharpen_texture
+#define GL_SGIS_sharpen_texture 1
+
+typedef void (GLAPIENTRY * PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat* points);
+typedef void (GLAPIENTRY * PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat* points);
+
+#define glGetSharpenTexFuncSGIS GLEW_GET_FUN(__glewGetSharpenTexFuncSGIS)
+#define glSharpenTexFuncSGIS GLEW_GET_FUN(__glewSharpenTexFuncSGIS)
+
+#define GLEW_SGIS_sharpen_texture GLEW_GET_VAR(__GLEW_SGIS_sharpen_texture)
+
+#endif /* GL_SGIS_sharpen_texture */
+
+/* --------------------------- GL_SGIS_texture4D --------------------------- */
+
+#ifndef GL_SGIS_texture4D
+#define GL_SGIS_texture4D 1
+
+typedef void (GLAPIENTRY * PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei extent, GLint border, GLenum format, GLenum type, const void* pixels);
+typedef void (GLAPIENTRY * PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei extent, GLenum format, GLenum type, const void* pixels);
+
+#define glTexImage4DSGIS GLEW_GET_FUN(__glewTexImage4DSGIS)
+#define glTexSubImage4DSGIS GLEW_GET_FUN(__glewTexSubImage4DSGIS)
+
+#define GLEW_SGIS_texture4D GLEW_GET_VAR(__GLEW_SGIS_texture4D)
+
+#endif /* GL_SGIS_texture4D */
+
+/* ---------------------- GL_SGIS_texture_border_clamp --------------------- */
+
+#ifndef GL_SGIS_texture_border_clamp
+#define GL_SGIS_texture_border_clamp 1
+
+#define GL_CLAMP_TO_BORDER_SGIS 0x812D
+
+#define GLEW_SGIS_texture_border_clamp GLEW_GET_VAR(__GLEW_SGIS_texture_border_clamp)
+
+#endif /* GL_SGIS_texture_border_clamp */
+
+/* ----------------------- GL_SGIS_texture_edge_clamp ---------------------- */
+
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_SGIS_texture_edge_clamp 1
+
+#define GL_CLAMP_TO_EDGE_SGIS 0x812F
+
+#define GLEW_SGIS_texture_edge_clamp GLEW_GET_VAR(__GLEW_SGIS_texture_edge_clamp)
+
+#endif /* GL_SGIS_texture_edge_clamp */
+
+/* ------------------------ GL_SGIS_texture_filter4 ------------------------ */
+
+#ifndef GL_SGIS_texture_filter4
+#define GL_SGIS_texture_filter4 1
+
+typedef void (GLAPIENTRY * PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat* weights);
+typedef void (GLAPIENTRY * PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat* weights);
+
+#define glGetTexFilterFuncSGIS GLEW_GET_FUN(__glewGetTexFilterFuncSGIS)
+#define glTexFilterFuncSGIS GLEW_GET_FUN(__glewTexFilterFuncSGIS)
+
+#define GLEW_SGIS_texture_filter4 GLEW_GET_VAR(__GLEW_SGIS_texture_filter4)
+
+#endif /* GL_SGIS_texture_filter4 */
+
+/* -------------------------- GL_SGIS_texture_lod -------------------------- */
+
+#ifndef GL_SGIS_texture_lod
+#define GL_SGIS_texture_lod 1
+
+#define GL_TEXTURE_MIN_LOD_SGIS 0x813A
+#define GL_TEXTURE_MAX_LOD_SGIS 0x813B
+#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C
+#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D
+
+#define GLEW_SGIS_texture_lod GLEW_GET_VAR(__GLEW_SGIS_texture_lod)
+
+#endif /* GL_SGIS_texture_lod */
+
+/* ------------------------- GL_SGIS_texture_select ------------------------ */
+
+#ifndef GL_SGIS_texture_select
+#define GL_SGIS_texture_select 1
+
+#define GLEW_SGIS_texture_select GLEW_GET_VAR(__GLEW_SGIS_texture_select)
+
+#endif /* GL_SGIS_texture_select */
+
+/* ----------------------------- GL_SGIX_async ----------------------------- */
+
+#ifndef GL_SGIX_async
+#define GL_SGIX_async 1
+
+#define GL_ASYNC_MARKER_SGIX 0x8329
+
+typedef void (GLAPIENTRY * PFNGLASYNCMARKERSGIXPROC) (GLuint marker);
+typedef void (GLAPIENTRY * PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range);
+typedef GLint (GLAPIENTRY * PFNGLFINISHASYNCSGIXPROC) (GLuint* markerp);
+typedef GLuint (GLAPIENTRY * PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range);
+typedef GLboolean (GLAPIENTRY * PFNGLISASYNCMARKERSGIXPROC) (GLuint marker);
+typedef GLint (GLAPIENTRY * PFNGLPOLLASYNCSGIXPROC) (GLuint* markerp);
+
+#define glAsyncMarkerSGIX GLEW_GET_FUN(__glewAsyncMarkerSGIX)
+#define glDeleteAsyncMarkersSGIX GLEW_GET_FUN(__glewDeleteAsyncMarkersSGIX)
+#define glFinishAsyncSGIX GLEW_GET_FUN(__glewFinishAsyncSGIX)
+#define glGenAsyncMarkersSGIX GLEW_GET_FUN(__glewGenAsyncMarkersSGIX)
+#define glIsAsyncMarkerSGIX GLEW_GET_FUN(__glewIsAsyncMarkerSGIX)
+#define glPollAsyncSGIX GLEW_GET_FUN(__glewPollAsyncSGIX)
+
+#define GLEW_SGIX_async GLEW_GET_VAR(__GLEW_SGIX_async)
+
+#endif /* GL_SGIX_async */
+
+/* ------------------------ GL_SGIX_async_histogram ------------------------ */
+
+#ifndef GL_SGIX_async_histogram
+#define GL_SGIX_async_histogram 1
+
+#define GL_ASYNC_HISTOGRAM_SGIX 0x832C
+#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D
+
+#define GLEW_SGIX_async_histogram GLEW_GET_VAR(__GLEW_SGIX_async_histogram)
+
+#endif /* GL_SGIX_async_histogram */
+
+/* -------------------------- GL_SGIX_async_pixel -------------------------- */
+
+#ifndef GL_SGIX_async_pixel
+#define GL_SGIX_async_pixel 1
+
+#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C
+#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D
+#define GL_ASYNC_READ_PIXELS_SGIX 0x835E
+#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F
+#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360
+#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361
+
+#define GLEW_SGIX_async_pixel GLEW_GET_VAR(__GLEW_SGIX_async_pixel)
+
+#endif /* GL_SGIX_async_pixel */
+
+/* ----------------------- GL_SGIX_blend_alpha_minmax ---------------------- */
+
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_SGIX_blend_alpha_minmax 1
+
+#define GL_ALPHA_MIN_SGIX 0x8320
+#define GL_ALPHA_MAX_SGIX 0x8321
+
+#define GLEW_SGIX_blend_alpha_minmax GLEW_GET_VAR(__GLEW_SGIX_blend_alpha_minmax)
+
+#endif /* GL_SGIX_blend_alpha_minmax */
+
+/* ---------------------------- GL_SGIX_clipmap ---------------------------- */
+
+#ifndef GL_SGIX_clipmap
+#define GL_SGIX_clipmap 1
+
+#define GLEW_SGIX_clipmap GLEW_GET_VAR(__GLEW_SGIX_clipmap)
+
+#endif /* GL_SGIX_clipmap */
+
+/* ------------------------- GL_SGIX_depth_texture ------------------------- */
+
+#ifndef GL_SGIX_depth_texture
+#define GL_SGIX_depth_texture 1
+
+#define GL_DEPTH_COMPONENT16_SGIX 0x81A5
+#define GL_DEPTH_COMPONENT24_SGIX 0x81A6
+#define GL_DEPTH_COMPONENT32_SGIX 0x81A7
+
+#define GLEW_SGIX_depth_texture GLEW_GET_VAR(__GLEW_SGIX_depth_texture)
+
+#endif /* GL_SGIX_depth_texture */
+
+/* -------------------------- GL_SGIX_flush_raster ------------------------- */
+
+#ifndef GL_SGIX_flush_raster
+#define GL_SGIX_flush_raster 1
+
+typedef void (GLAPIENTRY * PFNGLFLUSHRASTERSGIXPROC) (void);
+
+#define glFlushRasterSGIX GLEW_GET_FUN(__glewFlushRasterSGIX)
+
+#define GLEW_SGIX_flush_raster GLEW_GET_VAR(__GLEW_SGIX_flush_raster)
+
+#endif /* GL_SGIX_flush_raster */
+
+/* --------------------------- GL_SGIX_fog_offset -------------------------- */
+
+#ifndef GL_SGIX_fog_offset
+#define GL_SGIX_fog_offset 1
+
+#define GL_FOG_OFFSET_SGIX 0x8198
+#define GL_FOG_OFFSET_VALUE_SGIX 0x8199
+
+#define GLEW_SGIX_fog_offset GLEW_GET_VAR(__GLEW_SGIX_fog_offset)
+
+#endif /* GL_SGIX_fog_offset */
+
+/* -------------------------- GL_SGIX_fog_texture -------------------------- */
+
+#ifndef GL_SGIX_fog_texture
+#define GL_SGIX_fog_texture 1
+
+#define GL_TEXTURE_FOG_SGIX 0
+#define GL_FOG_PATCHY_FACTOR_SGIX 0
+#define GL_FRAGMENT_FOG_SGIX 0
+
+typedef void (GLAPIENTRY * PFNGLTEXTUREFOGSGIXPROC) (GLenum pname);
+
+#define glTextureFogSGIX GLEW_GET_FUN(__glewTextureFogSGIX)
+
+#define GLEW_SGIX_fog_texture GLEW_GET_VAR(__GLEW_SGIX_fog_texture)
+
+#endif /* GL_SGIX_fog_texture */
+
+#if 0
+/* ------------------- GL_SGIX_fragment_specular_lighting ------------------ */
+
+#ifndef GL_SGIX_fragment_specular_lighting
+#define GL_SGIX_fragment_specular_lighting 1
+
+typedef void (GLAPIENTRY * PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, GLint* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, const GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, const GLfloat param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, const GLint param);
+typedef void (GLAPIENTRY * PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint* params);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum value, const GLfloat* data);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum value, const GLint* data);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat* data);
+typedef void (GLAPIENTRY * PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint* data);
+
+#define glFragmentColorMaterialSGIX GLEW_GET_FUN(__glewFragmentColorMaterialSGIX)
+#define glFragmentLightModelfSGIX GLEW_GET_FUN(__glewFragmentLightModelfSGIX)
+#define glFragmentLightModelfvSGIX GLEW_GET_FUN(__glewFragmentLightModelfvSGIX)
+#define glFragmentLightModeliSGIX GLEW_GET_FUN(__glewFragmentLightModeliSGIX)
+#define glFragmentLightModelivSGIX GLEW_GET_FUN(__glewFragmentLightModelivSGIX)
+#define glFragmentLightfSGIX GLEW_GET_FUN(__glewFragmentLightfSGIX)
+#define glFragmentLightfvSGIX GLEW_GET_FUN(__glewFragmentLightfvSGIX)
+#define glFragmentLightiSGIX GLEW_GET_FUN(__glewFragmentLightiSGIX)
+#define glFragmentLightivSGIX GLEW_GET_FUN(__glewFragmentLightivSGIX)
+#define glFragmentMaterialfSGIX GLEW_GET_FUN(__glewFragmentMaterialfSGIX)
+#define glFragmentMaterialfvSGIX GLEW_GET_FUN(__glewFragmentMaterialfvSGIX)
+#define glFragmentMaterialiSGIX GLEW_GET_FUN(__glewFragmentMaterialiSGIX)
+#define glFragmentMaterialivSGIX GLEW_GET_FUN(__glewFragmentMaterialivSGIX)
+#define glGetFragmentLightfvSGIX GLEW_GET_FUN(__glewGetFragmentLightfvSGIX)
+#define glGetFragmentLightivSGIX GLEW_GET_FUN(__glewGetFragmentLightivSGIX)
+#define glGetFragmentMaterialfvSGIX GLEW_GET_FUN(__glewGetFragmentMaterialfvSGIX)
+#define glGetFragmentMaterialivSGIX GLEW_GET_FUN(__glewGetFragmentMaterialivSGIX)
+
+#define GLEW_SGIX_fragment_specular_lighting GLEW_GET_VAR(__GLEW_SGIX_fragment_specular_lighting)
+#endif
+
+#endif /* GL_SGIX_fragment_specular_lighting */
+
+/* --------------------------- GL_SGIX_framezoom --------------------------- */
+
+#ifndef GL_SGIX_framezoom
+#define GL_SGIX_framezoom 1
+
+typedef void (GLAPIENTRY * PFNGLFRAMEZOOMSGIXPROC) (GLint factor);
+
+#define glFrameZoomSGIX GLEW_GET_FUN(__glewFrameZoomSGIX)
+
+#define GLEW_SGIX_framezoom GLEW_GET_VAR(__GLEW_SGIX_framezoom)
+
+#endif /* GL_SGIX_framezoom */
+
+/* --------------------------- GL_SGIX_interlace --------------------------- */
+
+#ifndef GL_SGIX_interlace
+#define GL_SGIX_interlace 1
+
+#define GL_INTERLACE_SGIX 0x8094
+
+#define GLEW_SGIX_interlace GLEW_GET_VAR(__GLEW_SGIX_interlace)
+
+#endif /* GL_SGIX_interlace */
+
+/* ------------------------- GL_SGIX_ir_instrument1 ------------------------ */
+
+#ifndef GL_SGIX_ir_instrument1
+#define GL_SGIX_ir_instrument1 1
+
+#define GLEW_SGIX_ir_instrument1 GLEW_GET_VAR(__GLEW_SGIX_ir_instrument1)
+
+#endif /* GL_SGIX_ir_instrument1 */
+
+/* ------------------------- GL_SGIX_list_priority ------------------------- */
+
+#ifndef GL_SGIX_list_priority
+#define GL_SGIX_list_priority 1
+
+#define GLEW_SGIX_list_priority GLEW_GET_VAR(__GLEW_SGIX_list_priority)
+
+#endif /* GL_SGIX_list_priority */
+
+/* ------------------------- GL_SGIX_pixel_texture ------------------------- */
+
+#ifndef GL_SGIX_pixel_texture
+#define GL_SGIX_pixel_texture 1
+
+typedef void (GLAPIENTRY * PFNGLPIXELTEXGENSGIXPROC) (GLenum mode);
+
+#define glPixelTexGenSGIX GLEW_GET_FUN(__glewPixelTexGenSGIX)
+
+#define GLEW_SGIX_pixel_texture GLEW_GET_VAR(__GLEW_SGIX_pixel_texture)
+
+#endif /* GL_SGIX_pixel_texture */
+
+/* ----------------------- GL_SGIX_pixel_texture_bits ---------------------- */
+
+#ifndef GL_SGIX_pixel_texture_bits
+#define GL_SGIX_pixel_texture_bits 1
+
+#define GLEW_SGIX_pixel_texture_bits GLEW_GET_VAR(__GLEW_SGIX_pixel_texture_bits)
+
+#endif /* GL_SGIX_pixel_texture_bits */
+
+/* ------------------------ GL_SGIX_reference_plane ------------------------ */
+
+#ifndef GL_SGIX_reference_plane
+#define GL_SGIX_reference_plane 1
+
+typedef void (GLAPIENTRY * PFNGLREFERENCEPLANESGIXPROC) (const GLdouble* equation);
+
+#define glReferencePlaneSGIX GLEW_GET_FUN(__glewReferencePlaneSGIX)
+
+#define GLEW_SGIX_reference_plane GLEW_GET_VAR(__GLEW_SGIX_reference_plane)
+
+#endif /* GL_SGIX_reference_plane */
+
+/* ---------------------------- GL_SGIX_resample --------------------------- */
+
+#ifndef GL_SGIX_resample
+#define GL_SGIX_resample 1
+
+#define GL_PACK_RESAMPLE_SGIX 0x842E
+#define GL_UNPACK_RESAMPLE_SGIX 0x842F
+#define GL_RESAMPLE_DECIMATE_SGIX 0x8430
+#define GL_RESAMPLE_REPLICATE_SGIX 0x8433
+#define GL_RESAMPLE_ZERO_FILL_SGIX 0x8434
+
+#define GLEW_SGIX_resample GLEW_GET_VAR(__GLEW_SGIX_resample)
+
+#endif /* GL_SGIX_resample */
+
+/* ----------------------------- GL_SGIX_shadow ---------------------------- */
+
+#ifndef GL_SGIX_shadow
+#define GL_SGIX_shadow 1
+
+#define GL_TEXTURE_COMPARE_SGIX 0x819A
+#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B
+#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C
+#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D
+
+#define GLEW_SGIX_shadow GLEW_GET_VAR(__GLEW_SGIX_shadow)
+
+#endif /* GL_SGIX_shadow */
+
+/* ------------------------- GL_SGIX_shadow_ambient ------------------------ */
+
+#ifndef GL_SGIX_shadow_ambient
+#define GL_SGIX_shadow_ambient 1
+
+#define GL_SHADOW_AMBIENT_SGIX 0x80BF
+
+#define GLEW_SGIX_shadow_ambient GLEW_GET_VAR(__GLEW_SGIX_shadow_ambient)
+
+#endif /* GL_SGIX_shadow_ambient */
+
+/* ----------------------------- GL_SGIX_sprite ---------------------------- */
+
+#ifndef GL_SGIX_sprite
+#define GL_SGIX_sprite 1
+
+typedef void (GLAPIENTRY * PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param);
+typedef void (GLAPIENTRY * PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, GLfloat* params);
+typedef void (GLAPIENTRY * PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param);
+typedef void (GLAPIENTRY * PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, GLint* params);
+
+#define glSpriteParameterfSGIX GLEW_GET_FUN(__glewSpriteParameterfSGIX)
+#define glSpriteParameterfvSGIX GLEW_GET_FUN(__glewSpriteParameterfvSGIX)
+#define glSpriteParameteriSGIX GLEW_GET_FUN(__glewSpriteParameteriSGIX)
+#define glSpriteParameterivSGIX GLEW_GET_FUN(__glewSpriteParameterivSGIX)
+
+#define GLEW_SGIX_sprite GLEW_GET_VAR(__GLEW_SGIX_sprite)
+
+#endif /* GL_SGIX_sprite */
+
+/* ----------------------- GL_SGIX_tag_sample_buffer ----------------------- */
+
+#ifndef GL_SGIX_tag_sample_buffer
+#define GL_SGIX_tag_sample_buffer 1
+
+typedef void (GLAPIENTRY * PFNGLTAGSAMPLEBUFFERSGIXPROC) (void);
+
+#define glTagSampleBufferSGIX GLEW_GET_FUN(__glewTagSampleBufferSGIX)
+
+#define GLEW_SGIX_tag_sample_buffer GLEW_GET_VAR(__GLEW_SGIX_tag_sample_buffer)
+
+#endif /* GL_SGIX_tag_sample_buffer */
+
+/* ------------------------ GL_SGIX_texture_add_env ------------------------ */
+
+#ifndef GL_SGIX_texture_add_env
+#define GL_SGIX_texture_add_env 1
+
+#define GLEW_SGIX_texture_add_env GLEW_GET_VAR(__GLEW_SGIX_texture_add_env)
+
+#endif /* GL_SGIX_texture_add_env */
+
+/* -------------------- GL_SGIX_texture_coordinate_clamp ------------------- */
+
+#ifndef GL_SGIX_texture_coordinate_clamp
+#define GL_SGIX_texture_coordinate_clamp 1
+
+#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369
+#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A
+#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B
+
+#define GLEW_SGIX_texture_coordinate_clamp GLEW_GET_VAR(__GLEW_SGIX_texture_coordinate_clamp)
+
+#endif /* GL_SGIX_texture_coordinate_clamp */
+
+/* ------------------------ GL_SGIX_texture_lod_bias ----------------------- */
+
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_SGIX_texture_lod_bias 1
+
+#define GLEW_SGIX_texture_lod_bias GLEW_GET_VAR(__GLEW_SGIX_texture_lod_bias)
+
+#endif /* GL_SGIX_texture_lod_bias */